KEGG   Bos indicus (zebu cattle): 109555491
Entry
109555491         CDS       T04792                                 

Gene name
NLGN3
Definition
(RefSeq) neuroligin-3 isoform X1
  KO
K07378  neuroligin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109555491 (NLGN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109555491 (NLGN3)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    109555491 (NLGN3)
SSDB
Motif
Pfam: COesterase Abhydrolase_3
Other DBs
NCBI-GeneID: 109555491
NCBI-ProteinID: XP_019811972
Position
X
AA seq 848 aa
MWLWLGPPSLSLSPKPTVGRSLCLTLWFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPS
EILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATQFPPVCPQNIHTAVPEVMLP
VWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKICRKGGSGAKKQG
EDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSVLASYGNVIVITLNYRVG
VLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLS
HHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKEL
VEQDIQPARYHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDP
EDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTD
HQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWSDAAHGDEVPYVFGVPMVGPTD
LFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKFIHTKANRFEEVAWSKYNPRD
QLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITR
RPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASLLF
LNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLGPTHHECEAGPP
HDTLRLTTLPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLP
HSHSTTRV
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgtggctgtggcttggcccaccttcgctgtccctgagccccaagcccacagttggccgg
agcctgtgcctcaccttgtggttcctgagcttggtgctgagggccagtacccaggcccca
gcacccacagtcaacactcactttgggaagctaaggggtgcccgggtaccattgcccagt
gagatcctggggcctgtggaccagtaccttggggtgccctacgcagctcccccgatcggc
gagaaacgtttcctgccccctgaaccgcccccatcctggtcaggcatccggaacgccaca
cagtttcccccagtgtgcccccagaacatccacacagctgtgcccgaagtcatgcttcct
gtctggttcaccgccaacttggatatcgtcgctacttacatccaggagcctaacgaggac
tgcctctacctgaacgtctatgtgccaacggaggatgtaaagcggatttccaaggaatgc
gcccgaaagcccaacaagaaaatttgtaggaaaggaggatccggcgctaagaaacagggc
gaggacttagcggataatgacggggatgaagatgaagacatccgggacagtggcgctaag
cctgtcatggtctacatccatggaggctcttacatggaagggacaggcaacatgattgac
ggcagtgtcctggccagttatggcaacgtcatcgtcatcaccctcaactatcgggttgga
gtgctaggtttcctgagcactggcgatcaggctgccaagggaaactatgggctccttgac
caaatccaggccctccgctgggtgagcgagaatatcgccttctttggtggtgatccccgc
cgtatcaccgtctttggctcaggcattggtgcatcctgtgtcagcctcctcacactgtcg
catcattctgaagggcttttccagagggccatcatccaaagcggttctgctctgtccagc
tgggctgtgaactaccaaccggtgaagtacaccagcctgctggcagacaaggtgggctgt
aatgtgctagacacagttgacatggtggactgtcttcggcaaaagagtgccaaggagctg
gtagagcaagacatccagccagcccgctaccatgtggcttttggcccagtgattgatggt
gatgtcattcctgatgacccagagattctcatggaacagggcgagttcctcaactatgac
atcatgctaggtgtcaaccagggtgaggggctcaagtttgtggaaggggtggtggaccct
gaagatggtgtctctggcactgactttgactattcagtctccaactttgtggacaatctg
tatggctatcctgagggtaaggacaccctgcgggagaccatcaagttcatgtacacagac
tgggcagaccgtgacaatcctgagacccgccgtaagacattggtggcactcttcactgac
caccagtgggtggagccctcagtggtgacggctgatctgcatgcccgctatggctcgcct
acctacttctacgccttctaccatcactgccagagcctcatgaagcctgcttggtcagac
gcagctcatggggatgaagtaccctatgtttttggtgtccctatggtaggccccactgac
ctcttcccctgcaacttctccaagaatgacgttatgctcagtgctgttgtgatgacctac
tggaccaactttgccaagactggggatcccaacaagccggtcccccaggacaccaagttc
attcacaccaaggccaaccgctttgaggaagtggcctggtccaaatacaatccccgagac
cagctgtaccttcacatcgggctgaagccaagggtccgcgatcattaccgggccactaag
gtggccttttggaaacacttggtgccccacctatacaacctgcacgacatgttccactac
acgtccacaaccaccaaagtgccgcccccggataccacccacagctcccacatcacccgc
aggcccaatggcaagacctggagcaccaagcgaccagccatctctcccgcctacagcaac
gagaatgcccaggggtcctggaacggggaccaggatgcagggccactcctggtggagaac
ccacgtgactactccactgaattaagcgtcaccatcgctgtgggggcctccctcctgttc
cttaatgtcctggccttcgctgctctctactatcggaaggacaagcgacgtcaggagccc
ctgcggcagcccagccctcagaggggagctggggctcctgaactgggagctgctcctgag
gaggagctggcagcactgcaactgggtcccacacaccacgagtgtgaggcaggtcccccc
cacgacaccctgcgcctcaccacgctgcctgactacacgctgaccctgcggcgctcccct
gatgacattccactcatgacccccaacaccatcacyatgatccccaactccctggtgggg
ctgcagacattgcacccctataacacctttgccgcagggttcaacagtactgggctgccc
cactcacactccaccacccgggtatag

KEGG   Bos indicus (zebu cattle): 109562860
Entry
109562860         CDS       T04792                                 

Gene name
NLGN1
Definition
(RefSeq) neuroligin-1
  KO
K07378  neuroligin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109562860 (NLGN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109562860 (NLGN1)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    109562860 (NLGN1)
SSDB
Motif
Pfam: COesterase Sarcoglycan_2 Abhydrolase_3
Other DBs
NCBI-GeneID: 109562860
NCBI-ProteinID: XP_019821452
Position
1
AA seq 635 aa
MASHMPVPPQQGKKDFFKKGKRKVGAYSFLSTGDQAAKGNYGLLDLIQALRWTSENIGFF
GGDPLRITVFGSGAGGSCVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAVSFQ
PAKYARMLATKVGCNVSDTVELVECLQKKPYKELVDQDIQPARYHIAFGPVIDGDVIPDD
PQILMEQGEFLNYDIMLGVNQGEGLKFVENIVDSDDGISASDFDFAVSNFVDNLYGYPEG
KDVLRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAF
YHHCQTDQVPAWADAAHGDEVPYVLGIPMIGPTELFPCNFSKNDVMLSAVVMTYWTNFAK
TGDPNQPVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIGLKPRVKEHYRANKVNLWLE
LVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVD
QRDYSTELSVTIAVGASLLFLNILAFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAQEE
EIMSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTI
PGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggcgagccacatgccagtccccccacagcaaggaaagaaggacttttttaaaaaaggg
aaaaggaaggtgggagcatatagtttcttgagcacaggggatcaggctgcaaaaggaaac
tatggactccttgatctcatacaggctttaagatggactagtgagaatattggattcttt
ggtggtgaccccttaagaatcactgtttttggatctggcgctgggggttcatgtgtcaat
ctgctgactttatcccattattctgaaggtaaccgttggagcaattcaaccaaaggactc
tttcaacgagcaatagctcaaagtggaacagccctttccagctgggctgttagtttccaa
cctgcaaaatatgctagaatgttggccacaaaagttggttgcaatgtttcagatacagta
gagttagtggaatgcctgcagaagaagccttacaaagaacttgttgaccaagatattcaa
ccagcacgataccacatagcctttggacctgtgattgatggtgatgtgataccggatgac
cctcagatactgatggagcaaggagagtttctcaactatgatataatgttaggagtaaac
caaggggaaggattaaaatttgttgaaaatatagtagatagtgatgatggtatatctgct
agtgattttgactttgctgtttccaattttgttgataacttatatggatatcctgaaggc
aaagatgttttgagagaaaccattaaattcatgtatactgactgggctgaccgtcataac
cctgaaaccagaaggaagacattattagctttgtttacggaccaccagtgggtggcacca
gctgtagctacagcagatcttcactcaaattttggttcacccacctatttctatgccttt
taccatcattgccaaacagatcaggttccagcttgggctgatgcagctcatggagatgag
gttccctatgtactaggaatacccatgattggacctacagagttatttccttgcaatttc
tccaaaaatgatgtgatgctgagtgcagttgtaatgacatactggacaaattttgctaaa
actggtgacccaaatcaaccagtccctcaagacacaaaattcatccataccaaacccaac
cgctttgaagaagtagcatggaccagatattcccagaaagaccaactttatctccatatt
ggattaaaaccaagagttaaagaacattacagagccaataaggtaaacctctggttggag
ctggtacctcatctgcataatctcaatgacatttctcagtatacctcgacaacaactaaa
gtgccatcaactgacatcactttcagacctacgagaaaaaattccgtacctgtcacatca
gcctttcccactgccaagcaggatgatcccaaacaacagccaagtccattttcagtggat
caaagggactactcaacagagctgagcgtcactattgccgttggagcatccctactattt
ctgaacatcttggcctttgcagccctgtactacaaaaaggataagaggagacatgacgtt
cacaggagatgcagcccccagcgcacgactaccaatgatctgacccacgcacaagaagag
gagatcatgtccctccaaatgaagcacactgatttggatcatgaatgtgagtccatccat
ccacatgaggtggttcttcggaccgcctgccccccagattacacactagctatgaggagg
tcacctgatgatgttcccttaatgacacccaacaccatcacaatgattcccaacactata
ccagggattcaacccttacacacattcaatacatttactggaggacagaacaatactctg
ccccatccccacccccacccccattcacattcaacaaccagggtatag

KEGG   Bos indicus (zebu cattle): 109573240
Entry
109573240         CDS       T04792                                 

Gene name
NLGN2
Definition
(RefSeq) neuroligin-2
  KO
K07378  neuroligin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109573240 (NLGN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109573240 (NLGN2)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    109573240 (NLGN2)
SSDB
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9
Other DBs
NCBI-GeneID: 109573240
NCBI-ProteinID: XP_019835969
Position
19
AA seq 724 aa
MWLLALCLVGLAGAQRGGGGPGXXXXXXXGLGLSGLGEERFPVVNTAYGRVRGVRRELNN
EILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLP
VWFTDNLEAAATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDSGKKPVM
LFLHGGSYMEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQ
ALRWLSENIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSV
NYQPLKYTRLLAAKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYHIAFGPVVDGDVV
PDDPEILMQQGEFLNYDMLIGVNQGEGLKFVEDSAESEDGVSASAFDFTVSNFVDNLYGY
PEGKDVLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYF
YTFYHHCQAEDRPEWADAAHGDELPYVFGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTN
FAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAF
WLELVPHLHNLHTELFTTTTRLPPYATRWPPRPPPGAPGTRRPPPXXXXXPEPEPEPGPR
AYDRFPGDSRDYSTELSVTVAVGASLLFLNILAFAALYXKRDRRQELRCRRLSPPGGSGS
GVPG
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgtggctcctggcgctgtgtctggtggggctggcgggggctcaacgggggggagggggg
cccggcgnnnnnnnnnnnnnnnnnnngggcctgggtctcagcggcctcggggaggagcgc
ttcccagtggtgaacacggcctacgggcgagtgcgcggcgtgcggcgcgagctcaacaac
gagatcctgggcccggtcgtgcagttcctgggcgtgccctacgccacgccccccctgggc
gcccgccgctttcagccgcccgaggcccccgcctcgtggcccggcgtgcgcaacgccacg
accctgccgcccgcctgcccgcagaacctgcacggggcgctgccggccatcatgctgccc
gtgtggttcaccgacaacctggaggcggccgccacctacgtgcagaaccagagcgaggac
tgcctgtacctcaacctctacgtgcccaccgaggacggtccgctcacaaaaaaacgtgac
gaggcgacgctcaatccgccagacacagatatccgggactccgggaagaagccagtgatg
ctgtttctgcatggtggctcctacatggagggcacggggaacatgttcgatggctccgtc
ttggccgcctacggcaatgtcattgtagccacgctcaactaccggcttggggtgctcggt
tttctcagcactggggaccaggctgcaaaaggcaactatgggctcctagaccagatccag
gccctgcgctggctcagtgagaacatcgcccacttcgggggggaccctgaacgcatcacc
atcttcggatctggggcaggagcctcctgtgtcaacctcctgatcctctcccaccactcg
gaagggctgttccagaaggccattgcccagagcggcactgccatttctagctggtctgtc
aactaccagccactcaaatacacacgactgctggctgccaaggtgggctgtgaccgggag
gacagcgccgaggctgtggagtgtctgcgccggaagccctctcgggagctggtggaccag
gacgtgcagcctgcccgctaccacatcgcctttgggcctgtggtggacggtgatgtcgtc
cctgacgaccctgagatcctcatgcagcagggagaattcctcaactacgacatgctcatt
ggggtcaaccagggagagggcctcaagttcgtggaggactcggcagagagcgaggatggc
gtgtctgccagcgccttcgacttcacggtctccaacttcgtggacaacctgtacggctac
ccagagggcaaggatgtgctacgggagaccatcaagttcatgtacacggactgggccgac
cgggacaacggcgagatgcggcgcaagaccctactggcactctttaccgaccaccagtgg
gtggcaccggctgtggccaccgccaagctgcacgctgactaccagtcccctgtctacttt
tacaccttctaccaccactgccaggctgaggaccggcccgagtgggcggatgcagcgcat
ggggatgagctaccctatgtctttggtgtgcccatggtgggtgccaccgacctcttcccc
tgcaacttctccaagaatgacgtcatgctcagtgccgtggtcatgacctactggaccaac
ttcgccaagactggcgaccccaaccagccggtgccacaggacaccaagttcatccacacc
aagcccaaccgcttcgaggaggtggtgtggagcaagttcaacagcaaagagaagcagtac
ctgcacatcggtctgaagccgcgcgtgcgcgacaactaccgcgccaacaaggtggccttc
tggctggagctcgtgccgcacctgcacaatctgcacacggagctcttcaccaccaccacg
cgcctgccgccctacgccacgcgctggccgcctcgcccgccccccggcgccccgggcacg
cgccgcccgccgccccnnnnnnnnnnnncgcccgagcccgagcccgagccgggcccccgg
gcctacgaccgtttccccggggactcccgagactactccacggagctcagcgtcaccgtg
gccgtgggtgcctcgctcctcttcctcaacatcctcgcctttgccgccctctactrcaag
agggaccggcggcaggagctgcggtgccggcggctcagtccccccggtggctcgggctct
ggggtgcccggc

DBGET integrated database retrieval system