KEGG   Bos indicus (zebu cattle): 109555532
Entry
109555532         CDS       T04792                                 

Gene name
CD40LG
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04064  NF-kappa B signaling pathway
biu04514  Cell adhesion molecules
biu04660  T cell receptor signaling pathway
biu04672  Intestinal immune network for IgA production
biu05144  Malaria
biu05145  Toxoplasmosis
biu05310  Asthma
biu05320  Autoimmune thyroid disease
biu05322  Systemic lupus erythematosus
biu05330  Allograft rejection
biu05340  Primary immunodeficiency
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109555532 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109555532 (CD40LG)
   04514 Cell adhesion molecules
    109555532 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109555532 (CD40LG)
   04672 Intestinal immune network for IgA production
    109555532 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    109555532 (CD40LG)
   05322 Systemic lupus erythematosus
    109555532 (CD40LG)
   05320 Autoimmune thyroid disease
    109555532 (CD40LG)
   05330 Allograft rejection
    109555532 (CD40LG)
   05340 Primary immunodeficiency
    109555532 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109555532 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    109555532 (CD40LG)
   05145 Toxoplasmosis
    109555532 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109555532 (CD40LG)
   04090 CD molecules [BR:biu04090]
    109555532 (CD40LG)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Tumor necrosis fators
   109555532 (CD40LG)
CD molecules [BR:biu04090]
 Proteins
  109555532 (CD40LG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 109555532
NCBI-ProteinID: XP_019812028
Position
X
AA seq 261 aa
MIETYSQPSPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNKGEGSLSLLNCEEIRSRFEDLVKDIMQNKEVKKKEKNFEMHKGDQEP
QIAAHVISEASSKTTSVLQWAPKGYYTLSNNLVTLENGKQLAVKRQGFYYIYTQVTFCSN
RETLSQAPFIASLCLKSPSGSERILLRAANTHSSSKPCGQQSIHLGGVFELQSGASVFVN
VTDPSQVSHGTGFTSFGLLKL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgatcgaaacatacagtcaaccttctccccgctccgtggccactggaccacctgtcagt
atgaaaatttttatgtatttacttacagtttttcttatcacccagatgattgggtcagcg
ctttttgctgtgtatcttcacagaagattggacaagatagaagacgaaaggaatcttcat
gaagattttgtgttcatgaaaacgatacagagatgcaataaaggagaggggtccttatcc
ttactgaactgtgaggaaattagaagccggtttgaagacttggtcaaggatataatgcaa
aacaaagaagtaaagaagaaagaaaaaaactttgaaatgcacaaaggtgatcaggagcct
cagatagcggcacatgtcatcagtgaggccagtagtaaaacaacctctgttctccagtgg
gcccccaaaggatactacaccctaagcaacaacctggtaaccctcgaaaacgggaaacag
ctggccgtgaaaagacaaggattctattacatctacacccaagtcaccttctgttccaat
cgggaaactttgagtcaagctccatttatagccagcctctgcctgaagtccccaagtgga
tcagagagaatcttactgagagctgcaaacacccacagttcttccaaaccatgcgggcag
caatccattcacttaggaggagtctttgaattgcaatcgggtgcttcggtgtttgtcaat
gtgactgatccaagtcaagtgagccacgggacgggcttcacatcatttggcttactcaaa
ctctga

DBGET integrated database retrieval system