KEGG   Bos indicus (zebu cattle): 109555873
Entry
109555873         CDS       T04792                                 

Gene name
CD2
Definition
(RefSeq) T-cell surface antigen CD2
  KO
K06449  T-cell surface glycoprotein CD2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109555873 (CD2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109555873 (CD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109555873 (CD2)
   04090 CD molecules [BR:biu04090]
    109555873 (CD2)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109555873 (CD2)
CD molecules [BR:biu04090]
 Proteins
  109555873 (CD2)
SSDB
Motif
Pfam: V-set Ig_3 I-set Ig_2 Cadherin_C_2 C2-set EphA2_TM DUF5711 Receptor_2B4 FAM176
Other DBs
NCBI-GeneID: 109555873
NCBI-ProteinID: XP_019812293
Position
3
AA seq 338 aa
MNLACEILASFLLIFTVPTKGEDPESIVVWGALDHDLNLDIPGFPRSDIVADIKWNRNKN
KIARIKKDMPLHNEMDKYDMFTNGTLKIKTLMRNDSGLYEVEVYDSNGVNLLSKKFDLKI
QEMLSGPEINWICTNRTVSCKVENGSNPKLELFLNXTRVKQDHGKLITYTWNTRWNKTFK
CVASNHVDSKVSXEIAVCPDEGLDLYLIIGICVGGTVFLIFVALLIFYISRRKKQSRRRD
DEELEIKAQRAILEERGRKTQQTPVSTPANPGMSQTPPVPGHRSQPPAHRPRALGPRVQP
QQKRLPPTPGTQVHQQKGPPLPKPRVQTKPPCDAEENS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaacctcgcatgtgaaatcttagccagcttccttctgattttcactgttcccaccaaa
ggtgaagaccctgaaagcattgtcgtctggggtgccctggatcatgacctcaacctggac
attcctggttttccaagaagtgatatagtggcagatataaaatggaacagaaacaaaaac
aagattgcacgaataaagaaagatatgccacttcacaatgaaatggacaaatatgatatg
tttacaaatggaactctgaaaattaaaactctgatgagaaacgatagtggtctctatgag
gtagaggtttatgattcaaatggagtaaacctactgagcaaaaaatttgatttgaagatt
caagagatgctctcaggacctgaaattaactggatctgtaccaacagaactgtgagctgc
aaggtagaaaatggaagtaatcctaaattagaactgtttttaaataygacccgtgtcaaa
caagatcatgggaagctcatcacctacacgtggaacaccagatggaataaaacattcaag
tgcgtggcgagtaaccatgtcgatagcaaagtcagcayagagatcgccgtgtgtccagat
gaaggtctggatttgtacctcatcatcggcatttgtgtaggaggcaccgtcttcctcatc
ttcgtggcactactcattttctacatcagcaggaggaaaaaacagagccgcaggagagat
gatgaggagctggagataaaagcacagagagcaatccttgaggaaagaggccggaagact
caacagactccagtctcaactcctgcaaatccaggcatgtcccaaactcctccagtacct
ggccatcgttctcagccccccgctcatcgtccacgggctcttggcccccgtgtccagccc
cagcagaagaggcttcctccgacgccaggcacacaagttcaccagcaaaaaggccctccc
ctccccaagcctcgcgttcaaacgaaacctccctgtgacgccgaagaaaactcctaa

DBGET integrated database retrieval system