KEGG   Bos indicus (zebu cattle): 109555875
Entry
109555875         CDS       T04792                                 

Gene name
CD58
Definition
(RefSeq) lymphocyte function-associated antigen 3
  KO
K06492  CD58 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109555875 (CD58)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109555875 (CD58)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109555875 (CD58)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109555875 (CD58)
CD molecules [BR:biu04090]
 Proteins
  109555875 (CD58)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109555875 (CD58)
SSDB
Motif
Pfam: Ig_3 V-set ig Syndecan I-set Sortase DUF5463
Other DBs
NCBI-GeneID: 109555875
NCBI-ProteinID: XP_019812296
Position
3
AA seq 210 aa
MNGNVTFYVSKFHPSTEIIWKKEKNKVVEWDIQSGLEAFQSFKDRVYLDIGSGNLTITRL
TKSDEGLYELESPGVRNKSEFHLKVIAPPPSPSTFCSLSDDGNITLTCEIMEAGYDIDGN
LLQYSWECPPTVQCHRGLSPSEAYVLKKSDLSQNVQCIVSNPLFRTSASISLSTCVPEDN
TRHRYVLFAILPAVICGLLFLKCFLGRHSQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaatgggaatgtaaccttttacgtttcaaagtttcacccgagtacagagattatatgg
aagaaggagaagaataaagttgtagaatgggatatacaatctggactcgaagcttttcag
tcttttaaagatagagtttatttagacattgggtcaggtaacctcaccatcaccaggtta
acaaaatcagatgagggtctgtatgaacttgaatccccaggtgttagaaataagtccgag
ttccacctcaaagtgattgcacctcctccatcaccgtcaacattttgctcattgtctgat
gatggaaacattactctcacctgcgagatcatggaagcgggctatgacattgatggtaac
ctcctacagtattcgtgggaatgtccgccaacagtacagtgtcaccgtggcttgagtcca
tctgaagcatatgtcttaaagaaaagtgatctttcacagaatgttcaatgtatcgttagc
aatccattattcagaacatcagcttccatctctttgtcaacctgtgtgccagaggataat
acaaggcataggtatgtgctttttgccatactgccagcagtaatatgtggcttgctgttt
ttaaaatgttttctgggacgtcatagccaatga

KEGG   Bos indicus (zebu cattle): 109556769
Entry
109556769         CDS       T04792                                 

Definition
(RefSeq) lymphocyte function-associated antigen 3-like
  KO
K06492  CD58 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556769
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109556769
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556769
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109556769
CD molecules [BR:biu04090]
 Proteins
  109556769
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109556769
SSDB
Motif
Pfam: Ig_3 V-set ig I-set
Other DBs
NCBI-GeneID: 109556769
NCBI-ProteinID: XP_019813750
Position
3
AA seq 275 aa
MAGTTGTRTESARRGKDRRPDCIRGGAGRERRGGAREAGLALRQTELCGCEPLAETARTA
MAAGSAPGWALGVLGVVYLFLKLDFISCSQEIYGAMNGNVTFYVSKFHPSTEIIWKKEKN
KVVEWDIQSGLEAFQSFKDRVYLDIGSGNLTITRLTKSDEGLYELESPGVRNKSEFHLKV
IAPPPSPSTFCSLSDDGNITLTCEIMEAGYDIDGNLLQYSWECPPTVQCHRGLSPSEAYV
LKKSDLSQNVQCIVSNPLFRTSASISLSTCVPEGE
NT seq 828 nt   +upstreamnt  +downstreamnt
atggcaggaacgactgggacccgaaccgagtccgcgagaagaggaaaggaccggcgccca
gactgcatccgaggcggggcggggcgcgagaggcggggcggggcgcgagaggcggggctg
gccctccggcagacagagttgtgcggctgcgagccattagcagaaactgcccggaccgcc
atggccgcagggagcgcccctgggtgggccctgggggtccttggagtggtctacctgttc
ctcaaattggatttcatcagctgttctcaagaaatttatggagctatgaatgggaatgta
accttttacgtttcaaagtttcacccgagtacagagattatatggaagaaggagaagaat
aaagttgtagaatgggatatacaatctggactcgaagcttttcagtcttttaaagataga
gtttatttagacattgggtcaggtaacctcaccatcaccaggttaacaaaatcagatgag
ggtctgtatgaacttgaatccccaggtgttagaaataagtccgagttccacctcaaagtg
attgcacctcctccatcaccgtcaacattttgctcattgtctgatgatggaaacattact
ctcacctgcgagatcatggaagcgggctatgacattgatggtaacctcctacagtattcg
tgggaatgtccgccaacagtacagtgtcaccgtggcttgagtccatctgaagcatatgtc
ttaaagaaaagtgatctttcacagaatgttcaatgtatcgttagcaatccattattcaga
acatcagcttccatctctttgtcaacctgtgtgccagagggtgagtaa

DBGET integrated database retrieval system