KEGG   Bos indicus (zebu cattle): 109555878
Entry
109555878         CDS       T04792                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 2 isoform X1
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04064  NF-kappa B signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04621  NOD-like receptor signaling pathway
biu04668  TNF signaling pathway
biu05132  Salmonella infection
biu05145  Toxoplasmosis
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109555878
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109555878
   04064 NF-kappa B signaling pathway
    109555878
   04668 TNF signaling pathway
    109555878
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109555878
   04215 Apoptosis - multiple species
    109555878
   04217 Necroptosis
    109555878
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109555878
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109555878
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109555878
   05202 Transcriptional misregulation in cancer
    109555878
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109555878
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109555878
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109555878
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109555878
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109555878
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109555878
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109555878
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I32: IAP family
   109555878
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109555878
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 109555878
NCBI-ProteinID: XP_019812300
Position
3
AA seq 602 aa
MEDSTVLSNWTIGNKQKMTYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDNPIEKHKQLXPSCSFIQNLVSVTSLESTSKNASSPMRNSFTHSL
SPTLEHGRSFSGSYSNLSPNPINSRAVEDFSPLRTNPYSYAMSTEEARFLTYQMWPLTFL
SPSELARAGFYYIGPGDRVACFACGGTLNNWEPKDDAMLEHQKHFPSCPFLENSLETLRF
SISNLSMQTHAARLRTFMYWPSTVSVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPRCEFLIRMKGQEFVSEIQARYPHLLEQLLSTANTSGDENADPPIVHFG
PGESSSDDAVMMNTPVVKAALEMGFSRSLVKRTVQSKILTTGENYKTVNDIVSALLNAED
EKREEEKEEEKERQTEETASDDLSLLRRNRMALFQQLTCVLPILDNLLKANVINKQEHDI
IKQKTQIPLQARELIDTVLVKGNSAAXIFKNCLKEIDPTLYKNLFVEKNMKYIPTDVSGL
SLEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTF
LS
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggaagacagcacagtcttgtcaaattggacgattggcaacaaacaaaaaatgacatac
gacttttcatgtgagctctaccgaatgtctacatattcaactttccccgccggtgttcct
gtctcagaaaggagtcttgctcgtgctggtttttattacactggtgtgaatgacaaggtc
aaatgcttctgttgtggcctgatgctggataactggaaacaaggagacaatcctattgag
aagcataaacaactgtrtccgagctgtagctttattcagaatctagtttctgttactagt
ctggaatctacttctaagaatgcttcttctccaatgagaaacagttttacgcactcatta
tcacccactttggaacatggtagatcattcagtggttcttattccaacctttcaccaaac
cctattaattctcgagcagtcgaagacttttccccattgaggactaacccctacagttat
gccatgagtactgaagaagcgagatttcttacttatcaaatgtggccattaacctttctg
tcaccatcagaattggcaagagctggcttttattatataggacctggagacagggtagcc
tgctttgcctgtggtgggacgctaaataactgggaaccaaaggatgatgccatgttagaa
caccagaaacattttcccagctgtccatttttggaaaattctctggaaacgctgaggttc
agcatttcaaatttgagtatgcagacacatgcagctcgcctgagaacatttatgtactgg
ccatctactgtatcagttcagcccgagcagcttgcaagtgctggtttctattatgtaggt
cgcaacgacgatgtcaagtgcttttgttgtgatggtggcttaaggtgttgggaatctgga
gatgacccatgggtagaacacgccaaatggtttccaaggtgtgagttcttgatacgaatg
aaagggcaggagtttgttagtgagattcaagccagatatcctcatcttcttgaacagctc
ttgtcaactgcaaatacytctggagatgaaaatgctgatccaccaattgttcattttgga
cctggagaaagttcttcagacgatgcagtcatgatgaatacacctgtggttaaagctgcc
ttggaaatgggctttagtagaagcctggtaaagcggacagttcagagtaaaatcctaaca
actggagagaattacaaaacagttaatgatattgtgtcagcacttcttaatgctgaagat
gagaaaagagaagaagaaaaggaggaagagaaggaaagacaaactgaagaaacagcatca
gatgatttgtcattacttcggaggaatagaatggctctctttcaacagttgacgtgtgtg
cttcctatcctggataatcttttaaaggccaatgtaattaataaacaggagcatgatatt
attaagcaaaaaacacagatacctttacaagcaagagaactgattgataccgttttagtt
aaaggaaatagtgctgccarcatcttcaaaaactgtcttaaggaaattgaccctacatta
tataagaacttgtttgtggaaaagaatatgaagtatattccaacagatgtttcaggtctg
tccctggaagagcagttgagaaggctgcaagaagaaagaacttgtaaagtgtgtatggac
aaagaagtttctattgtattcattccttgtggtcatctggtagtatgccaggaatgtgcc
ccttctctaagaaaatgccctatttgcagaggtataattaagggtactgttcgtacattt
ctctcataa

KEGG   Bos indicus (zebu cattle): 109568764
Entry
109568764         CDS       T04792                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04064  NF-kappa B signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04621  NOD-like receptor signaling pathway
biu04668  TNF signaling pathway
biu05132  Salmonella infection
biu05145  Toxoplasmosis
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109568764 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109568764 (BIRC3)
   04064 NF-kappa B signaling pathway
    109568764 (BIRC3)
   04668 TNF signaling pathway
    109568764 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109568764 (BIRC3)
   04215 Apoptosis - multiple species
    109568764 (BIRC3)
   04217 Necroptosis
    109568764 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109568764 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109568764 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568764 (BIRC3)
   05202 Transcriptional misregulation in cancer
    109568764 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109568764 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109568764 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109568764 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109568764 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109568764 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109568764 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109568764 (BIRC3)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I32: IAP family
   109568764 (BIRC3)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109568764 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 DUF2039 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 109568764
NCBI-ProteinID: XP_019829719
Position
15
AA seq 573 aa
MNIVENSVFLSNLMKSANMFELKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
KDKVKCFCCGLMLDNWKQGDNPIEKHKKLYPSCSFVQNLNSINVSGASSQPTFHSSLTNS
THSLLPSLENSGYFSGSYSSFPSNLLNSGPNQDFSALRISSYPCAMNTEKARLLTFQMWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGTLSNWEPKDDAMSEHLRHFPNCPFLGNQLQ
GTSRYTASNLSMQTYAARIKTFCSWPSSVPVHPEQLASAGFYYVGHSDDVKCFCCDGGLR
CWESGDDPWVEHAKWFPRCEYLIQIKGQEFISRVQASYPHLLEQLLSTSDNPEDENTESP
SMYTNNNCYIQSTSVLILNYGCFHSVICVYVEGSLQTEFECDYVCVLFYKDDLSLIRKNR
MALFQHLTCVLPILDSLLTARVISEQEHDVIKQKTQTSLQARELIDTILVKGNFAATIFK
NSLQEIDPMLYKRLFVQQDIKYIPTENVSDLPMEEQLRRLQEERTCKVCMDKEVSIVFIP
CGHLVVCKDCAPSLRKCPICRGTIKGTVRTFLS
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgaatatagtagaaaatagcgtattcttatcaaatttgatgaagagtgccaacatgttt
gaactgaagtatgacttttcatgtgagctctaccgaatgtcaacatactcaactttcccc
gccggtgtacctgtctcagaaaggagtcttgctcgtgctggtttttattacactggtgtg
aaagacaaagtcaaatgcttctgttgtggactgatgctggataactggaaacaaggagac
aatcccattgagaagcataaaaagttgtatcctagctgtagctttgttcagaatctaaat
tcaattaacgtttcaggagcctcttctcagcctacttttcattcttcattaacgaattcc
acacattcactacttcccagcttggaaaacagtggctacttcagtggctcttattcaagc
tttccatcaaatcttttaaactctggaccaaatcaggacttttctgccttgaggataagt
tcctacccttgtgcaatgaatactgaaaaagccagattacttaccttccagatgtggccg
ttgacttttctgtcaccaacagacctggcaaaagcaggcttttattacataggacctgga
gatagagtggcttgctttgcctgtggtggaacattgagcaattgggaaccgaaggatgat
gctatgtcagaacacctgagacatttccccaactgtccgtttttaggaaatcagctccaa
ggcacttcaaggtacactgcttctaatctgagcatgcagacatatgcagcccgcattaaa
acattctgcagctggccctctagtgttccagttcatcctgagcagcttgcaagcgcaggt
ttttattatgtgggtcacagtgatgatgtgaaatgcttttgctgtgatggtggactgagg
tgttgggaatctggagatgatccatgggtggaacatgccaagtggtttccacggtgtgag
tacttaatacaaattaaaggacaagagttcattagtcgagttcaagccagttaccctcat
ctacttgaacagctgttatctacttcagacaatccagaagatgaaaatacagagtcacca
agtatgtatactaataataactgctacattcaatcaacttcagtgctgatactgaattat
ggttgttttcattcagttatatgtgtatatgtggaaggaagtttgcagacagagtttgaa
tgtgattatgtttgtgttcttttctataaagatgacctgtcattaatccggaagaataga
atggcactttttcaacatctgacttgtgtgcttccaattctggatagtctcctaactgcc
agggtgattagtgaacaagaacatgatgttattaaacagaaaacacaaacatctttacaa
gcaagagaactgattgatactattttagtgaaaggaaattttgcagccaccatattcaaa
aactctctacaagaaattgatcccatgttatacaagcgtttatttgtgcaacaagacata
aaatacattcctacagaaaatgtttcagatttaccaatggaagaacagttgaggagacta
caagaagaaagaacatgtaaagtgtgtatggacaaagaagtgtccatagtgtttattcct
tgtggtcatctagtagtttgcaaagactgtgccccttctctaagaaaatgccctatttgt
agaggtacaatcaagggtacagttcgtacatttctttcgtga

KEGG   Bos indicus (zebu cattle): 109569840
Entry
109569840         CDS       T04792                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat-containing protein 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04064  NF-kappa B signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04390  Hippo signaling pathway
biu04510  Focal adhesion
biu04621  NOD-like receptor signaling pathway
biu04668  TNF signaling pathway
biu05132  Salmonella infection
biu05145  Toxoplasmosis
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109569840 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109569840 (BIRC2)
   04064 NF-kappa B signaling pathway
    109569840 (BIRC2)
   04668 TNF signaling pathway
    109569840 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109569840 (BIRC2)
   04215 Apoptosis - multiple species
    109569840 (BIRC2)
   04217 Necroptosis
    109569840 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109569840 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109569840 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569840 (BIRC2)
   05202 Transcriptional misregulation in cancer
    109569840 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109569840 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109569840 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109569840 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109569840 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109569840 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109569840 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109569840 (BIRC2)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I32: IAP family
   109569840 (BIRC2)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    109569840 (BIRC2)
SSDB
Motif
Pfam: BIR OTT_1508_deam
Other DBs
NCBI-GeneID: 109569840
NCBI-ProteinID: XP_019831145
Position
15
AA seq 317 aa
MEDSTVLSNWTIGNKQKMTYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKV
KCFCCGLMLDNWKQGDNPIEKHKQLYPSCSFIQNLVSVTSLESTSKNASSPMRNSFTHSL
SPTLEHGRSFSGSYSNLSPNPINSRAVEDFSPLRTNPYSYAMSTEEARFLTYQMWPLTFL
SPSELARAGFYYIGPGDRVACFACGGTLNNWEPKDDAMLEHQKHFPSCPFLENSLETLRF
SISNLSMQTHAARLRTFMYWPSTVSVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESG
DDPWVEHAKWFPSLERI
NT seq 954 nt   +upstreamnt  +downstreamnt
atggaagacagcacagtcttgtcaaattggacaattggcaacaaacaaaaaatgacatac
gacttttcatgtgagctctaccgaatgtctacatattcaactttccccgccggtgttcct
gtctcagaaaggagtcttgctcgtgctggtttttattacactggtgtgaatgacaaggtc
aaatgcttctgttgtggcctgatgctggataactggaaacaaggagacaatcctattgag
aagcataaacaactgtatccgagctgtagctttattcagaatctagtttctgttactagt
ctggaatctacttctaagaatgcttcttctccaatgagaaacagttttacgcactcatta
tcacccactttggaacatggtagatcattcagtggttcttattccaacctttcaccaaac
cctattaattctcgagcagtcgaagacttttccccattgaggactaacccctacagttat
gccatgagtactgaagaagcaagatttcttacttatcaaatgtggccattaacctttctg
tcaccatcagaattggcaagagctggcttttattatataggacctggagacagggtagcc
tgctttgcctgtggtgggacgctaaataactgggaaccaaaggatgatgccatgttagaa
caccagaaacattttcccagctgtccatttttggaaaattctytggaaacgctgaggttc
agcatttcaaatttgagtatgcagacacatgcagctcgcctgagaacatttatgtactgg
ccatctactgtatcagttcagcccgagcagcttgcaagtgctggtttctattatgtaggt
cgcaacgacgatgtcaagtgcttttgttgtgatggtggcttaaggtgttgggaatctgga
gatgacccatgggtagaacacgccaaatggtttccaagcctggaaagaatttag

KEGG   Bos indicus (zebu cattle): 109574440
Entry
109574440         CDS       T04792                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04390  Hippo signaling pathway
biu05161  Hepatitis B
biu05200  Pathways in cancer
biu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109574440 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109574440 (BIRC5)
   04215 Apoptosis - multiple species
    109574440 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574440 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109574440 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109574440 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109574440 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109574440 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109574440 (BIRC5)
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I32: IAP family
   109574440 (BIRC5)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     109574440 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109574440 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 109574440
NCBI-ProteinID: XP_019838018
Position
19
AA seq 142 aa
MGAQSLPPAWQLYLKDHRVSTFKNWPFLEGCACTPERMAAAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERTKNKIAKETNNK
QKEFEETAKKVRCAIEQLAALE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgcccagtctttgcctccggcctggcagctctacctcaaggaccaccgcgtctcc
acgtttaagaactggcctttcttagagggctgcgcctgcaccccggagcggatggccgcg
gcaggcttcatccactgtcccactgagaacgagcccgacttggctcagtgtttcttctgc
ttcaaggagttggaaggctgggaaccagatgacgaccctatagaagaacataaaaagcat
tcatctggttgtgctttcctttctgtcaagaagcagtttgaagaattaaccctcagtgaa
tttttgaaactggataaagaaagaaccaagaacaaaatcgcaaaagaaaccaacaataag
cagaaagaatttgaagaaactgcaaagaaagtccgctgtgccattgagcagctggctgcc
ttggagtga

DBGET integrated database retrieval system