KEGG   Bos indicus (zebu cattle): 109555882
Entry
109555882         CDS       T04792                                 

Gene name
NGF
Definition
(RefSeq) beta-nerve growth factor
  KO
K02582  nerve growth factor, beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04722  Neurotrophin signaling pathway
biu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109555882 (NGF)
   04014 Ras signaling pathway
    109555882 (NGF)
   04015 Rap1 signaling pathway
    109555882 (NGF)
   04151 PI3K-Akt signaling pathway
    109555882 (NGF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109555882 (NGF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109555882 (NGF)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109555882 (NGF)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109555882 (NGF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109555882 (NGF)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109555882 (NGF)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Others
   109555882 (NGF)
Cytokines and growth factors [BR:biu04052]
 Growth factors
  Growth factors (RTK binding)
   109555882 (NGF)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 109555882
NCBI-ProteinID: XP_019812306
Position
3
AA seq 241 aa
MSMLFYTLITALLIGIQAAPHTESNVPAGHAIPQAHWIKLQHSLDTVLRRAHSAPAGPIA
ARVAGQTHNITVDPKLFKKRRLRSPRVLFSTQPPPVAADTQDLDFEAGGASSFNRTHRSK
RSSSHPVFHRGEFSVCDSISVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCR
DPNPVDSGCRGIDAKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKTGQR
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccatgttgttctacactctgatcacagctcttttgatcggcatacaggcagcaccg
cacaccgagagcaatgtcccagctggacacgccatccctcaagcccactggattaaactt
cagcattcccttgacacagtcctccgcagagcccacagcgccccggctgggccgatagct
gccagggtggcagggcagacccacaacatcactgtggaccccaaactttttaaaaagcgg
cgactgcgttcacctcgcgtgctgttcagcacccaacccccacccgtggccgcagacact
caggatctggacttcgaggcgggcggggcctcctccttcaacaggactcacaggagcaag
cggtcgtcatcccaccccgtctttcaccggggggagttctcggtgtgcgacagcatcagc
gtgtgggtgggggacaagacaacggccacggacatcaagggcaaggaggtgatggtgctg
ggagaggtgaacatcaacaacagtgtattcaaacagtacttttttgagaccaagtgccgg
gaccccaaccccgtggacagcgggtgccgaggcatcgacgcgaagcactggaattcgtat
tgcaccacgacccacaccttcgtcaaggcgctgaccatggacggcaagcaggccgcctgg
cggttcatccggatcgacacggcctgcgtgtgtgtgctcagcaggaagactgggcagaga
gcctga

DBGET integrated database retrieval system