KEGG   Bos indicus (zebu cattle): 109555890
Entry
109555890         CDS       T04792                                 

Gene name
NRAS
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04062  Chemokine signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04714  Thermogenesis
biu04720  Long-term potentiation
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04730  Long-term depression
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05034  Alcoholism
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109555890 (NRAS)
   04012 ErbB signaling pathway
    109555890 (NRAS)
   04014 Ras signaling pathway
    109555890 (NRAS)
   04015 Rap1 signaling pathway
    109555890 (NRAS)
   04370 VEGF signaling pathway
    109555890 (NRAS)
   04371 Apelin signaling pathway
    109555890 (NRAS)
   04068 FoxO signaling pathway
    109555890 (NRAS)
   04072 Phospholipase D signaling pathway
    109555890 (NRAS)
   04071 Sphingolipid signaling pathway
    109555890 (NRAS)
   04151 PI3K-Akt signaling pathway
    109555890 (NRAS)
   04150 mTOR signaling pathway
    109555890 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109555890 (NRAS)
   04137 Mitophagy - animal
    109555890 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    109555890 (NRAS)
   04218 Cellular senescence
    109555890 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109555890 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    109555890 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109555890 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109555890 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    109555890 (NRAS)
   04660 T cell receptor signaling pathway
    109555890 (NRAS)
   04662 B cell receptor signaling pathway
    109555890 (NRAS)
   04664 Fc epsilon RI signaling pathway
    109555890 (NRAS)
   04062 Chemokine signaling pathway
    109555890 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109555890 (NRAS)
   04929 GnRH secretion
    109555890 (NRAS)
   04912 GnRH signaling pathway
    109555890 (NRAS)
   04915 Estrogen signaling pathway
    109555890 (NRAS)
   04917 Prolactin signaling pathway
    109555890 (NRAS)
   04921 Oxytocin signaling pathway
    109555890 (NRAS)
   04926 Relaxin signaling pathway
    109555890 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    109555890 (NRAS)
   04919 Thyroid hormone signaling pathway
    109555890 (NRAS)
   04916 Melanogenesis
    109555890 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    109555890 (NRAS)
   04726 Serotonergic synapse
    109555890 (NRAS)
   04720 Long-term potentiation
    109555890 (NRAS)
   04730 Long-term depression
    109555890 (NRAS)
   04722 Neurotrophin signaling pathway
    109555890 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    109555890 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    109555890 (NRAS)
   04213 Longevity regulating pathway - multiple species
    109555890 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    109555890 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109555890 (NRAS)
   05206 MicroRNAs in cancer
    109555890 (NRAS)
   05205 Proteoglycans in cancer
    109555890 (NRAS)
   05203 Viral carcinogenesis
    109555890 (NRAS)
   05230 Central carbon metabolism in cancer
    109555890 (NRAS)
   05231 Choline metabolism in cancer
    109555890 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109555890 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109555890 (NRAS)
   05225 Hepatocellular carcinoma
    109555890 (NRAS)
   05226 Gastric cancer
    109555890 (NRAS)
   05214 Glioma
    109555890 (NRAS)
   05216 Thyroid cancer
    109555890 (NRAS)
   05221 Acute myeloid leukemia
    109555890 (NRAS)
   05220 Chronic myeloid leukemia
    109555890 (NRAS)
   05218 Melanoma
    109555890 (NRAS)
   05211 Renal cell carcinoma
    109555890 (NRAS)
   05219 Bladder cancer
    109555890 (NRAS)
   05215 Prostate cancer
    109555890 (NRAS)
   05213 Endometrial cancer
    109555890 (NRAS)
   05224 Breast cancer
    109555890 (NRAS)
   05223 Non-small cell lung cancer
    109555890 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109555890 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    109555890 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109555890 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109555890 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    109555890 (NRAS)
   05161 Hepatitis B
    109555890 (NRAS)
   05160 Hepatitis C
    109555890 (NRAS)
   05163 Human cytomegalovirus infection
    109555890 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109555890 (NRAS)
   05165 Human papillomavirus infection
    109555890 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109555890 (NRAS)
   01522 Endocrine resistance
    109555890 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109555890 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109555890 (NRAS)
   04031 GTP-binding proteins [BR:biu04031]
    109555890 (NRAS)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109555890 (NRAS)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109555890 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   109555890 (NRAS)
  Exosomal proteins of breast cancer cells
   109555890 (NRAS)
  Exosomal proteins of colorectal cancer cells
   109555890 (NRAS)
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109555890 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 109555890
NCBI-ProteinID: XP_019812316
Position
3
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagata
aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaagctcaacagcagtgatgatggcactcaaggc
tgtatggggttgccgtgtgtggtgatgtaa

KEGG   Bos indicus (zebu cattle): 109559581
Entry
109559581         CDS       T04792                                 

Gene name
KRAS
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04062  Chemokine signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04714  Thermogenesis
biu04720  Long-term potentiation
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04730  Long-term depression
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu05010  Alzheimer disease
biu05034  Alcoholism
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559581 (KRAS)
   04012 ErbB signaling pathway
    109559581 (KRAS)
   04014 Ras signaling pathway
    109559581 (KRAS)
   04015 Rap1 signaling pathway
    109559581 (KRAS)
   04370 VEGF signaling pathway
    109559581 (KRAS)
   04371 Apelin signaling pathway
    109559581 (KRAS)
   04068 FoxO signaling pathway
    109559581 (KRAS)
   04072 Phospholipase D signaling pathway
    109559581 (KRAS)
   04071 Sphingolipid signaling pathway
    109559581 (KRAS)
   04151 PI3K-Akt signaling pathway
    109559581 (KRAS)
   04150 mTOR signaling pathway
    109559581 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109559581 (KRAS)
   04137 Mitophagy - animal
    109559581 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    109559581 (KRAS)
   04218 Cellular senescence
    109559581 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109559581 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    109559581 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109559581 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109559581 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    109559581 (KRAS)
   04660 T cell receptor signaling pathway
    109559581 (KRAS)
   04662 B cell receptor signaling pathway
    109559581 (KRAS)
   04664 Fc epsilon RI signaling pathway
    109559581 (KRAS)
   04062 Chemokine signaling pathway
    109559581 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109559581 (KRAS)
   04929 GnRH secretion
    109559581 (KRAS)
   04912 GnRH signaling pathway
    109559581 (KRAS)
   04915 Estrogen signaling pathway
    109559581 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    109559581 (KRAS)
   04917 Prolactin signaling pathway
    109559581 (KRAS)
   04921 Oxytocin signaling pathway
    109559581 (KRAS)
   04926 Relaxin signaling pathway
    109559581 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    109559581 (KRAS)
   04919 Thyroid hormone signaling pathway
    109559581 (KRAS)
   04916 Melanogenesis
    109559581 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109559581 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    109559581 (KRAS)
   04726 Serotonergic synapse
    109559581 (KRAS)
   04720 Long-term potentiation
    109559581 (KRAS)
   04730 Long-term depression
    109559581 (KRAS)
   04722 Neurotrophin signaling pathway
    109559581 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    109559581 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    109559581 (KRAS)
   04213 Longevity regulating pathway - multiple species
    109559581 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    109559581 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559581 (KRAS)
   05206 MicroRNAs in cancer
    109559581 (KRAS)
   05205 Proteoglycans in cancer
    109559581 (KRAS)
   05203 Viral carcinogenesis
    109559581 (KRAS)
   05230 Central carbon metabolism in cancer
    109559581 (KRAS)
   05231 Choline metabolism in cancer
    109559581 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109559581 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109559581 (KRAS)
   05212 Pancreatic cancer
    109559581 (KRAS)
   05225 Hepatocellular carcinoma
    109559581 (KRAS)
   05226 Gastric cancer
    109559581 (KRAS)
   05214 Glioma
    109559581 (KRAS)
   05216 Thyroid cancer
    109559581 (KRAS)
   05221 Acute myeloid leukemia
    109559581 (KRAS)
   05220 Chronic myeloid leukemia
    109559581 (KRAS)
   05218 Melanoma
    109559581 (KRAS)
   05211 Renal cell carcinoma
    109559581 (KRAS)
   05219 Bladder cancer
    109559581 (KRAS)
   05215 Prostate cancer
    109559581 (KRAS)
   05213 Endometrial cancer
    109559581 (KRAS)
   05224 Breast cancer
    109559581 (KRAS)
   05223 Non-small cell lung cancer
    109559581 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559581 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    109559581 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109559581 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559581 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    109559581 (KRAS)
   05161 Hepatitis B
    109559581 (KRAS)
   05160 Hepatitis C
    109559581 (KRAS)
   05163 Human cytomegalovirus infection
    109559581 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559581 (KRAS)
   05165 Human papillomavirus infection
    109559581 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109559581 (KRAS)
   01522 Endocrine resistance
    109559581 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109559581 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:biu04031]
    109559581 (KRAS)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109559581 (KRAS)
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109559581 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha ATP_bind_1 Gtr1_RagA Septin FeoB_N AAA_25
Other DBs
NCBI-GeneID: 109559581
NCBI-ProteinID: XP_019816991
Position
5
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGXPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacrgcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaaytcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

KEGG   Bos indicus (zebu cattle): 109560940
Entry
109560940         CDS       T04792                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04062  Chemokine signaling pathway
biu04068  FoxO signaling pathway
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04144  Endocytosis
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04371  Apelin signaling pathway
biu04510  Focal adhesion
biu04540  Gap junction
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04714  Thermogenesis
biu04720  Long-term potentiation
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04730  Long-term depression
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05034  Alcoholism
biu05132  Salmonella infection
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05216  Thyroid cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109560940
   04012 ErbB signaling pathway
    109560940
   04014 Ras signaling pathway
    109560940
   04015 Rap1 signaling pathway
    109560940
   04370 VEGF signaling pathway
    109560940
   04371 Apelin signaling pathway
    109560940
   04630 JAK-STAT signaling pathway
    109560940
   04068 FoxO signaling pathway
    109560940
   04072 Phospholipase D signaling pathway
    109560940
   04071 Sphingolipid signaling pathway
    109560940
   04151 PI3K-Akt signaling pathway
    109560940
   04150 mTOR signaling pathway
    109560940
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109560940
   04140 Autophagy - animal
    109560940
   04137 Mitophagy - animal
    109560940
  09143 Cell growth and death
   04210 Apoptosis
    109560940
   04218 Cellular senescence
    109560940
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109560940
   04540 Gap junction
    109560940
   04550 Signaling pathways regulating pluripotency of stem cells
    109560940
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109560940
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109560940
   04650 Natural killer cell mediated cytotoxicity
    109560940
   04660 T cell receptor signaling pathway
    109560940
   04662 B cell receptor signaling pathway
    109560940
   04664 Fc epsilon RI signaling pathway
    109560940
   04062 Chemokine signaling pathway
    109560940
  09152 Endocrine system
   04910 Insulin signaling pathway
    109560940
   04929 GnRH secretion
    109560940
   04912 GnRH signaling pathway
    109560940
   04915 Estrogen signaling pathway
    109560940
   04917 Prolactin signaling pathway
    109560940
   04921 Oxytocin signaling pathway
    109560940
   04926 Relaxin signaling pathway
    109560940
   04935 Growth hormone synthesis, secretion and action
    109560940
   04919 Thyroid hormone signaling pathway
    109560940
   04916 Melanogenesis
    109560940
  09156 Nervous system
   04725 Cholinergic synapse
    109560940
   04726 Serotonergic synapse
    109560940
   04720 Long-term potentiation
    109560940
   04730 Long-term depression
    109560940
   04722 Neurotrophin signaling pathway
    109560940
  09158 Development and regeneration
   04360 Axon guidance
    109560940
  09149 Aging
   04211 Longevity regulating pathway
    109560940
   04213 Longevity regulating pathway - multiple species
    109560940
  09159 Environmental adaptation
   04714 Thermogenesis
    109560940
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109560940
   05206 MicroRNAs in cancer
    109560940
   05205 Proteoglycans in cancer
    109560940
   05203 Viral carcinogenesis
    109560940
   05230 Central carbon metabolism in cancer
    109560940
   05231 Choline metabolism in cancer
    109560940
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109560940
  09162 Cancer: specific types
   05210 Colorectal cancer
    109560940
   05225 Hepatocellular carcinoma
    109560940
   05226 Gastric cancer
    109560940
   05214 Glioma
    109560940
   05216 Thyroid cancer
    109560940
   05221 Acute myeloid leukemia
    109560940
   05220 Chronic myeloid leukemia
    109560940
   05218 Melanoma
    109560940
   05211 Renal cell carcinoma
    109560940
   05219 Bladder cancer
    109560940
   05215 Prostate cancer
    109560940
   05213 Endometrial cancer
    109560940
   05224 Breast cancer
    109560940
   05223 Non-small cell lung cancer
    109560940
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109560940
  09165 Substance dependence
   05034 Alcoholism
    109560940
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109560940
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109560940
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109560940
   05170 Human immunodeficiency virus 1 infection
    109560940
   05161 Hepatitis B
    109560940
   05160 Hepatitis C
    109560940
   05163 Human cytomegalovirus infection
    109560940
   05167 Kaposi sarcoma-associated herpesvirus infection
    109560940
   05165 Human papillomavirus infection
    109560940
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109560940
   01522 Endocrine resistance
    109560940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109560940
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109560940
   04031 GTP-binding proteins [BR:biu04031]
    109560940
Membrane trafficking [BR:biu04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109560940
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109560940
  Exosomal proteins of colorectal cancer cells
   109560940
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109560940
SSDB
Motif
Pfam: Ras
Other DBs
NCBI-GeneID: 109560940
NCBI-ProteinID: XP_019818944
Position
7
AA seq 164 aa
MRKSALTIQLIENHPVEDNSTMEEGWLSLSSYWKQVVTDGETYLLDTAGQESQRHGDQYM
STSEGFPLGVCINNTESFKGIHQPWEQIKWVKDSDGIPVVLVGTSVTWSWYRRVSAGQNL
TQNCSVPCRQLLDLWLQLRDPLEPTSIPLTQQPLKLAPQGPSQP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaggaagagtgccctgaccatccagctcatcgagaaccaccccgtggaggacaactcc
accatggaggaaggttggctgtctctaagttcctactggaagcaagtggtcactgatggg
gagacctacctactggacacagcaggccaggagagtcagcgtcatggagaccagtacatg
agcaccagcgagggctttcctctgggtgtttgcatcaacaataccgagtccttcaagggc
atccaccagccctgggagcagatcaagtgggtgaaggactcagatggcatacctgtggtg
ctggtgggaacgagtgtgacctggtcatggtaccgtcgagtctcagcaggccagaacctc
acccaaaactgcagcgtcccctgcaggcagctgctcgacctctggcttcagctaagggac
cccctggaacccacttcgattcccctgacccagcagcccctcaagctagcgccccaaggt
cccagtcagccctga

DBGET integrated database retrieval system