KEGG   Bos indicus (zebu cattle): 109556011
Entry
109556011         CDS       T04792                                 

Definition
(RefSeq) vascular cell adhesion protein 1-like
  KO
K06527  vascular cell adhesion molecule 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04514  Cell adhesion molecules
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05143  African trypanosomiasis
biu05144  Malaria
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109556011
   04668 TNF signaling pathway
    109556011
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556011
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109556011
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109556011
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109556011
  09174 Infectious disease: parasitic
   05144 Malaria
    109556011
   05143 African trypanosomiasis
    109556011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556011
   04091 Lectins [BR:biu04091]
    109556011
CD molecules [BR:biu04090]
 Proteins
  109556011
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109556011
SSDB
Motif
Pfam: C2-set I-set Ig_3 ig Ig_2 V-set Ig_4 Ig_6 Ig_5 C2-set_2 ICAM_N C1-set Receptor_2B4 Adhes-Ig_like TrkA_C
Other DBs
NCBI-GeneID: 109556011
NCBI-ProteinID: XP_019812534
Position
3
AA seq 740 aa
MPKKMFVIFGVSNILWMVFAVSQAIKVDMFPDESKIFAQIGDSVSLTCSATGCESPSLSW
RTQMDSPLNGKVRNEGTTSTLIMDPVSFEDEHQYLCTVICGAAKLEKAIQVEIYSFSKDP
EIHLSSPAEVGKPVTVTCSVPDVYPFERLEIELLKGNHPMKVQDFLEPSEKKAQETKSLD
VTFSPTDEDIGTALVCQATLHIYDDDSPPKVRKTTKELEVYISPKDTAISVNPSTRLQEG
DSVTMTCTSAGLPAPRILWSKKLDNGNRQLLSENATLTLISMRAEDSGIYVCEGNNPVGK
DRKEVKLTVQEKMFTVEISPGPQIAAQVGDSVVLTCDVRDCESPSFSWRTQIDSPLNGKV
RREGSKSTLTLSPVSFENEHFYLCTVICGQKKLEKGIQVELYSFPSDPEIEMSGPLVNGN
PVTVSCKVPNVYPSDRLEIELFKGESIMMNKIFLEDVSKKALETKSLEMTFIPTVEDTGN
VLVCLAQLPIDEMEFEPKQRQSTQILYVNVAPRDTTILVSPSSTLEEGSSVNMTCSSNGL
PAPKILWSRQLSNGDLQPISENATLSFMSTKMEDSGIYVCEGINQAGISRKEVNLIIQVA
PKDIQLTAFPSERVKEGDTVIISCICGNVPPTLIILKKKAETGYIVLKSTGGAYTIHRAQ
LEDAGVYQCESKNEVGSQLRSLTLDVKGRESNKDYFSPEFLVLYCASALILTAIGMIIYF
ARKANMTGSYSLVEAQRTKV
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgcctaagaagatgtttgtgatctttggagtctcaaatatactttggatggtgtttgca
gtttctcaagctatcaaagttgacatgttcccagatgaatccaagatttttgctcagatt
ggtgactctgtttcactgacttgtagcgcaacaggctgtgagtctccatcattgtcttgg
agaactcagatggacagtccactgaatgggaaggtgagaaatgaagggaccacatccacg
ctgatcatggatcctgttagtttcgaggatgaacaccagtacctgtgcacagtgatttgc
ggggctgcgaaactggagaaagcaatccaagtggagatctactctttctctaaggatcca
gagattcatttgagtagccccgcagaggtcgggaagccagtcacagtcacgtgttcagtg
cctgatgtttacccatttgaaaggctggagatagagttgttgaaaggcaaccatcccatg
aaagtacaggactttctggagccttcagaaaaaaaggcccaggaaacaaagagcctggac
gtgaccttctcgcctactgatgaggatattgggacagctcttgtttgtcaagctacatta
cacatttatgatgatgattctccacccaaagtaaggaaaactacaaaagaactggaagtc
tacatctcccccaaagacacggctatatccgtgaatccctccacaaggctgcaggaaggc
gactccgtgacgatgacgtgtaccagtgcaggtytaccagctccacggattctctggagc
aagaaattagacaatgggaaccgacagctcctttctgagaatgcaactctcactttaatt
tctatgagggcagaagattctgggatttatgtgtgtgaaggaaataaccctgttgggaaa
gacagaaaagaggtgaaattaactgttcaagagaaaatgtttactgttgagatctctcct
ggaccccagattgctgctcaggttggcgactcagtcgtgttgacctgtgatgtcagggac
tgcgagtccccatctttctcttggagaacccagatagacagccctctgaatgggaaggtg
aggagggagggctccaagtccacgttgacactgagccctgtgagttttgagaacgaacat
ttttacctgtgcactgtgatatgtgggcaaaagaaactggaaaagggaatccaggtggag
ctctactccttccctagcgatccagaaattgaaatgagtggtccattagtgaatggaaac
ccagtcactgtaagctgcaaggttcctaatgtgtatccttctgaccggctggagattgaa
ttgtttaaaggggagagtattatgatgaataaaatctttttggaagatgtaagtaagaaa
gccctagagaccaagagtttagagatgaccttcatccccaccgttgaagatactggaaat
gttcttgtttgtctggctcagttacctattgatgaaatggaatttgaacccaaacaaagg
cagagtacacagatactttatgttaatgttgctcccagggatacaaccatcttggtcagt
ccctcctccaccctggaggaaggtagttctgtgaatatgacatgctctagcaatggcctt
ccagctcccaaaatcttgtggagcaggcagctaagtaatggggatctacagcctatttct
gagaatgcaactctcagcttcatgtctacaaaaatggaagattctggcatttatgtctgt
gaaggcattaaccaggctggaataagcagaaaagaagtcaacttaattatccaagttgct
ccaaaagatatacaacttacagcttttccctctgagagggtcaaagaaggagacactgtc
attatctcctgtatatgtgggaatgttcccccaactttgataattctgaagaaaaaagca
gagactggctacatagtgctaaagtctacaggtggtgcatataccatccacagggctcag
ttagaggatgcgggagtataccaatgtgaatctaaaaatgaagttggctcacagctaaga
agcctaacacttgatgttaaaggaagagaaagtaacaaggactatttttctcctgaattt
ctcgtgctctattgtgcatccgccttaatattaactgccattggaatgattatttacttt
gctagaaaagccaacatgacagggtcatacagccttgtagaagcacagagaacaaaagtg
tag

KEGG   Bos indicus (zebu cattle): 109556012
Entry
109556012         CDS       T04792                                 

Definition
(RefSeq) vascular cell adhesion protein 1-like isoform X1
  KO
K06527  vascular cell adhesion molecule 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04064  NF-kappa B signaling pathway
biu04514  Cell adhesion molecules
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05143  African trypanosomiasis
biu05144  Malaria
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109556012
   04668 TNF signaling pathway
    109556012
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556012
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109556012
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109556012
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109556012
  09174 Infectious disease: parasitic
   05144 Malaria
    109556012
   05143 African trypanosomiasis
    109556012
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556012
   04091 Lectins [BR:biu04091]
    109556012
CD molecules [BR:biu04090]
 Proteins
  109556012
Lectins [BR:biu04091]
 I-type lectins (Siglecs)
  109556012
SSDB
Motif
Pfam: C2-set I-set Ig_3 ig Ig_2 V-set Ig_4 Ig_6 C2-set_2 Ig_5 ICAM_N C1-set Adhes-Ig_like Receptor_2B4
Other DBs
NCBI-GeneID: 109556012
NCBI-ProteinID: XP_019812535
Position
3
AA seq 739 aa
MLRKMFVIFGASDVLWMVFAVSQASQIDIFPSESKIFAQIGDSVSLTCSTTGCESPSLSW
RTQIDSPLNGKVKTEGTTSMLIMDPVSFKDEHQYLCTAICKDKKLEKAIRVEIYSFSKDP
EIHLSSPPEVGKPVTVTCSVPDVYPFERLEIELLKGNRPMKVQDFLEPSEKKAQETKSLD
VTFSPTDEDIGTALVCQATLHIYDDDSPPKVRKTTKELEVYISPKDTAISVNPSTRLQEG
DSVTMTCASAGLPAPRILWSKKLDNGNXQLLSENATLTLISMRAEDSGIYVCEGNNPVGK
DRKEVKLIVQEKNFTVEISPGPQIAAQVGDSVVLTCDVRDCESPSFSWRTLIDSPLNGNV
RNEGSKSTLTLSPVSFENEHFYLCTVMCGQKKLEKRIQVKPYSFPSDPEIEMSGPLVSGN
PVTVSCRVPNVYPSDRLEIELFKGESIMMNKTFSKDLSKKALETKSLEKTFIPTTEDTGN
VLVCLARLPIDEMEFELKQRQSTQTLYVNVAPRDTTILVSPSSILEEGSSVNMTCSSNGL
PAPQILWSRQLSNGDLQPISENATLSFMSTKMEDSGIYVCEGINQVGTSRKEVNLIIQVA
PKDIQLTAFPSEXVKEGDTVIISCTCGNVPPTLIILKKKAETGYTVLKSTGGAYTIHRAQ
LEDAGVYQCESKNEVGSQLRSLTLDVKGRESNKDYFSPELLVLYCASSLIIPAIGMIIYF
ARRANMTGSYSLVEAQKVC
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgcttaggaagatgtttgtgatctttggagcctcagatgtactttggatggtgtttgca
gtttctcaagcttcccaaatcgacatattcccaagtgaatccaaaatttttgcgcagatt
ggtgactctgtttcactgacttgcagcacaacaggctgtgagtccccatcattgtcttgg
agaactcagattgacagtccactgaatggaaaggtgaaaactgaggggaccacatccatg
ctgatcatggatcctgttagtttcaaggatgaacaccagtacctgtgcacagcgatttgc
aaggataagaaactggagaaagcaatccgagtggagatctactctttctctaaggatcca
gagattcatttgagtagccccccagaggtcgggaagccagtcacagtcacatgttcggtg
cctgatgtttacccatttgaaaggctggagatagagttgttgaaaggcaaccgtcccatg
aaagtacaggactttctggagccttcagaaaaaaaggcccaggaaacaaagagcctggac
gtgaccttctcgcctactgatgaggatattgggacagctcttgtttgtcaagctacatta
cacatttatgatgatgattctccacccaaagtaaggaaaactacaaaagaactggaagtc
tacatctcccccaaagacacagctatatccgtgaatccctccacaaggctgcaggaaggc
gactccgtgacgatgacgtgtgccagtgcaggtctaccagctccacggattctctggagc
aagaaattagacaatgggaacckacagctcctttctgagaatgcaactctcactttaatt
tctatgagggcagaagattctgggatttatgtgtgtgaaggaaataaccctgttgggaaa
gacagaaaagaggtgaaattaattgttcaagagaaaaactttactgttgagatctctcct
ggaccccagattgctgctcaggttggcgactcagtcgtgttgacctgtgatgtcagggac
tgcgagtccccatctttctcttggagaacmctgatagacagccctctgaatgggaatgtg
aggaatgagggctccaagtccacgttgaccctgagccctgtgagttttgagaacgaacat
ttctacctgtgcactgtgatgtgtgggcaaaagaaactggaaaagagaatccaggtgaag
ccctactccttccctagcgatccagaaattgaaatgagtggcccattagtgagtggaaac
ccagtcactgtaagctgcagggttcctaatgtgtatccttctgaccggctggagattgaa
ttgtttaaaggggagagtattatgatgaataaaaccttctcgaaagatttaagtaagaaa
gccctagagaccaagagtttggagaagaccttcatccccaccactgaagatactggaaat
gttcttgtttgtctggctcggttaccaattgatgaaatggaatttgaactcaaacaaagg
cagagtacacaaacactttatgttaatgttgctcccagggatacaaccatcttggtcagt
ccctcctccatcctggaggaaggtagttctgtgaatatgacatgctctagcaatggcctt
ccagctccccaaatcttgtggagcaggcagctaagtaatggggatctacagcctatttct
gagaatgcaactctcagcttcatgtctacaaaaatggaagattctggcatttatgtctgt
gaaggcattaaccaggttggaacaagcagaaaagaagtcaacttaattatccaagttgct
ccaaaagatatacaacttacagcttttccttctgagagkgtcaaggaaggagacactgtc
attatctcctgtacgtgtggaaatgttcccccaactttgataattctgaagaaaaaagca
gagactggctacacagtgctaaagtctacaggtggtgcatataccatccacagggctcag
ttagaggatgcgggagtataccagtgtgaatctaaaaatgaagttggctcacagctaaga
agcctaacacttgatgttaaaggaagagaaagtaacaaggactatttttctcctgaactt
ctggtgctctattgtgcatcctccttaataatacctgccattggaatgattatttacttt
gctagaagagccaacatgacagggtcatacagtcttgtagaagcacagaaagtctgctaa

DBGET integrated database retrieval system