KEGG   Bos indicus (zebu cattle): 109556041
Entry
109556041         CDS       T04792                                 

Definition
(RefSeq) tissue factor
  KO
K03901  coagulation factor III (tissue factor)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109556041
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109556041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556041
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109556041
CD molecules [BR:biu04090]
 Proteins
  109556041
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109556041
SSDB
Motif
Pfam: Tissue_fac Interfer-bind ECSCR DUF3827 Shisa
Other DBs
NCBI-GeneID: 109556041
NCBI-ProteinID: XP_019812585
Position
3
AA seq 292 aa
MATPNGPRVPCPQAAVARALLFGLVLIQGAGVAGTTDVVVAYNITWKSTNFKTILEWEPK
PINHVYTVQISPRLGNWKNKCFYTTNTECDVTDEIVKNVSETYLARVLSYPADTSSSTVE
PPFTNSPEFKPYLETNLGQPTIQSFEQVGTKLNVTVQDARTLVRANSAFLSLRDVFGKDL
NYTLYYWKASSTGKKKATTNTNGFLIDVDKGENYCFHVQAVILSRRVNQKSPESPIKCTS
HEKVLSTELFFIIGTVMLVIIIFIVVLSVSLHKCRKVRAERSGKENTPLNAA
NT seq 879 nt   +upstreamnt  +downstreamnt
atggcgacccccaacgggccccgggtgccctgcccccaggccgcagtcgctcgggctctt
ctattcggcttagtcctcatccagggggccggagtcgccggcactacagatgtagtggta
gcatataatataacttggaagtcaactaatttcaagaccattttggagtgggaacccaaa
cccatcaatcatgtctacactgttcagataagccctagattaggaaactggaaaaacaaa
tgcttttacacaacaaacacggagtgtgatgtcactgatgagattgtgaaaaatgtgagc
gagacatatttggcgagagtcctttcctaccccgcagacactagcagttccacagtggag
cctccgtttaccaactccccggagttcaaaccctacctagagacaaaccttggacagcca
acaattcagagtttcgaacaagttgggacaaaactgaatgtgacggtacaagatgcacgt
acgttagtcagagcgaacagcgcattcctaagcctccgggatgtttttggcaaggacttg
aattacacactttattactggaaagcttccagtacaggaaagaaaaaggccacgacaaac
actaatgggtttttgattgatgtggataaaggcgaaaactattgtttccatgttcaagca
gtgattctatcacgaagggtgaaccagaagagtccagaaagtcccatcaagtgcactagc
cacgagaaagttctgtccacagaacttttcttcatcattggcacagtgatgctggtgatc
atcatcttcatcgtcgtcctgtctgtgtctctgcacaagtgcaggaaggtgagagcagag
cgaagtgggaaggagaacacgccgctcaacgctgcataa

KEGG   Bos indicus (zebu cattle): 109556805
Entry
109556805         CDS       T04792                                 

Definition
(RefSeq) tissue factor-like
  KO
K03901  coagulation factor III (tissue factor)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109556805
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109556805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556805
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109556805
CD molecules [BR:biu04090]
 Proteins
  109556805
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109556805
SSDB
Motif
Pfam: Interfer-bind Tissue_fac ECSCR DUF3827 Shisa
Other DBs
NCBI-GeneID: 109556805
NCBI-ProteinID: XP_019813774
Position
3
AA seq 264 aa
SLLFKGTTDVVVAYNITWKSTNFKTILEWEPKPINHVYTVQISPRLGNWKNKCFYTTNTE
CDVTDEIVKNVSETYLARVLSYPADTSSSTVEPPFTNSPEFKPYLETNLGQPTIQSFEQV
GTKLNVTVQDARTLVRANSAFLSLRDVFGKDLNYTLYYWKASSTGKKKATTNTNGFLIDV
DKGENYCFHVQAVILSRRVNQKSPESPIKCTSHEKVLSTELFFIIGTVMLVIIIFIVVLS
VSLHKCRKVRAERSGKENTPLNAA
NT seq 795 nt   +upstreamnt  +downstreamnt
tctctgttgtttaaaggcactacagatgtagtggtagcatataatataacttggaagtca
actaatttcaagaccattttggagtgggaacccaaacccatcaatcatgtctacactgtt
cagataagccctagattaggaaactggaaaaacaaatgcttttacacaacaaacacggag
tgtgatgtcactgatgagattgtgaaaaatgtgagcgagacatatttggcgagagtcctt
tcctaccccgcagacactagcagttccacagtggagcctccgtttaccaactccccggag
ttcaaaccctacctagagacaaaccttggacagccaacaattcagagtttcgaacaagtt
gggacaaaactgaatgtgacggtacaagatgcacgtacgttagtcagagcgaacagcgca
ttcctaagcctccgggatgtttttggcaaggacttgaattacacactttattactggaaa
gcttccagtacaggaaagaaaaaggccacgacaaacactaatgggtttttgattgatgtg
gataaaggcgaaaactattgtttccatgttcaagcagtgattctatcacgaagggtgaac
cagaagagtccagaaagtcccatcaagtgcactagccacgagaaagttctgtccacagaa
cttttcttcatcattggcacagtgatgctggtgatcatcatcttcatcgtcgtcctgtct
gtgtctctgcacaagtgcaggaaggtgagagcagagcgaagtgggaaggagaacacgccg
ctcaacgctgcataa

DBGET integrated database retrieval system