KEGG   Bos indicus (zebu cattle): 109556165
Entry
109556165         CDS       T04792                                 

Gene name
NEGR1
Definition
(RefSeq) neuronal growth regulator 1
  KO
K06775  neuronal growth regulator 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556165 (NEGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109556165 (NEGR1)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  IgLON family
   109556165 (NEGR1)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Izumo-Ig Ig_5 Ig_4 C2-set_2 V-set_CD47 Ig_C17orf99
Other DBs
NCBI-GeneID: 109556165
NCBI-ProteinID: XP_019812824
Position
3
AA seq 354 aa
MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRC
YLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV
QTQHTPRTMQVHLTVQVPPKIYDISHDMTINEGTNVTLTCLATGKPEPSISWRHISPSAK
PFENGQYLDIYGITRDQAGEYECSAENDVSFPDVKKVKIVVNFAPTIQEIKSGTVAPGRS
GLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAV
NKLGTTNASLPLSPPSTAQYGITGSADVLFSCWYLVLTLSSFTSLFYLKNAILQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggacatgatgctgttggtgcagggtgcttgttgctcgaaccagtggctggcggcggtg
ctcctcagcctgtgctgcctgctaccctcctgcctcccggctggacagagtgtggacttc
ccctgggcggctgtggacaacatgatggtcagaaaaggggacacggcggtgcttaggtgt
tatttggaagatggagcttcaaagggtgcctggctgaatcggtcaagtattatttttgcg
ggaggtgataagtggtcagtggatcctcgagtttcaatttcaacattgaataaaagggac
tacagcctccagatacagaatgtagatgtgacagatgatggcccgtacacatgttctgtt
cagactcagcatacaccaagaacaatgcaggtgcatctgactgtgcaagttcctccgaag
atttatgacatctcacacgatatgaccatcaatgaaggaaccaatgtcacccttacttgt
ttggccactgggaaaccagagccttccatttcttggcggcacatctctccatcagcaaaa
ccatttgaaaacggacaatatttggacatctatggaattacaagggaccaggctggagaa
tatgaatgcagtgcagaaaatgatgtgtcattcccagatgtgaaaaaagtgaaaattgtc
gtaaactttgctcctacaattcaggaaattaaatctggyaccgtggcccccggacgcagt
ggattgataagatgcgaaggtgcaggtgtgccgcctccggcctttgaatggtacaaaggg
gagaagaagctcttcaatggccaacaaggaattatcattcaaaattttagcacaagatct
attctcactgttaccaatgtgacacaggagcacttcggcaactatacttgtgtggctgtc
aacaagctaggcacaaccaacgcgagcctgcctctcagccctccaagtacagcccagtac
ggaattaccgggagcgctgacgttcttttctcctgctggtaccttgtgttgacactgtcc
tctttcaccagcttattctacctgaagaatgccattctacaataa

DBGET integrated database retrieval system