KEGG   Bos indicus (zebu cattle): 109556176
Entry
109556176         CDS       T04792                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04218  Cellular senescence
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109556176 (GADD45A)
   04064 NF-kappa B signaling pathway
    109556176 (GADD45A)
   04068 FoxO signaling pathway
    109556176 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109556176 (GADD45A)
   04210 Apoptosis
    109556176 (GADD45A)
   04115 p53 signaling pathway
    109556176 (GADD45A)
   04218 Cellular senescence
    109556176 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556176 (GADD45A)
   05202 Transcriptional misregulation in cancer
    109556176 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109556176 (GADD45A)
   05212 Pancreatic cancer
    109556176 (GADD45A)
   05225 Hepatocellular carcinoma
    109556176 (GADD45A)
   05226 Gastric cancer
    109556176 (GADD45A)
   05214 Glioma
    109556176 (GADD45A)
   05216 Thyroid cancer
    109556176 (GADD45A)
   05220 Chronic myeloid leukemia
    109556176 (GADD45A)
   05217 Basal cell carcinoma
    109556176 (GADD45A)
   05218 Melanoma
    109556176 (GADD45A)
   05213 Endometrial cancer
    109556176 (GADD45A)
   05224 Breast cancer
    109556176 (GADD45A)
   05222 Small cell lung cancer
    109556176 (GADD45A)
   05223 Non-small cell lung cancer
    109556176 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109556176 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109556176 (GADD45A)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109556176 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109556176 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109556176
NCBI-ProteinID: XP_019812852
Position
3
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcaaaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tacgaggcggccaagctgctcaacgtcgacccggataacgtggtgctgtgcctgctggcg
gcggacgaagacgacgacagggacgtggctctgcagatccacttcaccctgatccaggca
ttctgctgtgagaatgatatcgacatcctgcgtgtcagcaacccgggccggctggccgaa
ctcttgctcctggagaccgatgcgggccccgcggccagcgagggcgcagagcagcccccg
gacctgcactgcgtgctggtgacgaatccgcattcatcacagtggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

KEGG   Bos indicus (zebu cattle): 109561788
Entry
109561788         CDS       T04792                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04218  Cellular senescence
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109561788 (GADD45B)
   04064 NF-kappa B signaling pathway
    109561788 (GADD45B)
   04068 FoxO signaling pathway
    109561788 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109561788 (GADD45B)
   04210 Apoptosis
    109561788 (GADD45B)
   04115 p53 signaling pathway
    109561788 (GADD45B)
   04218 Cellular senescence
    109561788 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561788 (GADD45B)
   05202 Transcriptional misregulation in cancer
    109561788 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109561788 (GADD45B)
   05212 Pancreatic cancer
    109561788 (GADD45B)
   05225 Hepatocellular carcinoma
    109561788 (GADD45B)
   05226 Gastric cancer
    109561788 (GADD45B)
   05214 Glioma
    109561788 (GADD45B)
   05216 Thyroid cancer
    109561788 (GADD45B)
   05220 Chronic myeloid leukemia
    109561788 (GADD45B)
   05217 Basal cell carcinoma
    109561788 (GADD45B)
   05218 Melanoma
    109561788 (GADD45B)
   05213 Endometrial cancer
    109561788 (GADD45B)
   05224 Breast cancer
    109561788 (GADD45B)
   05222 Small cell lung cancer
    109561788 (GADD45B)
   05223 Non-small cell lung cancer
    109561788 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109561788 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109561788 (GADD45B)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109561788 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109561788 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109561788
NCBI-ProteinID: XP_019820084
Position
7
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQLQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCENDIDIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDTWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacactggaagagctcgtggcgtgcgacaacgcggcgcagaagatgcagacggtgagc
gccgcggtggaggagttgctggtggccgcgcagctccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggatcccgacagcgtggtcctgtgccttctggcc
atcgacgaggaagaggaggacgacatcgccctgcagatccacttcacgcttattcagtcc
ttctgctgcgaaaacgacatcgacatcgtgcgggtgtcggggatgcagcgcttggcgcag
ctactgggcgagccggccgagacccagggcaccaccgaggcccgggacctgcactgtctc
ctggtcacgaaccctcacacagacacctggaaaagccacggcctggtggaggtggccagt
tactgcgaagaaagtagggggaacaaccagtgggttccctacatctccctccaggagcgc
tga

KEGG   Bos indicus (zebu cattle): 109563283
Entry
109563283         CDS       T04792                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04064  NF-kappa B signaling pathway
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04218  Cellular senescence
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109563283 (GADD45G)
   04064 NF-kappa B signaling pathway
    109563283 (GADD45G)
   04068 FoxO signaling pathway
    109563283 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109563283 (GADD45G)
   04210 Apoptosis
    109563283 (GADD45G)
   04115 p53 signaling pathway
    109563283 (GADD45G)
   04218 Cellular senescence
    109563283 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109563283 (GADD45G)
   05202 Transcriptional misregulation in cancer
    109563283 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109563283 (GADD45G)
   05212 Pancreatic cancer
    109563283 (GADD45G)
   05225 Hepatocellular carcinoma
    109563283 (GADD45G)
   05226 Gastric cancer
    109563283 (GADD45G)
   05214 Glioma
    109563283 (GADD45G)
   05216 Thyroid cancer
    109563283 (GADD45G)
   05220 Chronic myeloid leukemia
    109563283 (GADD45G)
   05217 Basal cell carcinoma
    109563283 (GADD45G)
   05218 Melanoma
    109563283 (GADD45G)
   05213 Endometrial cancer
    109563283 (GADD45G)
   05224 Breast cancer
    109563283 (GADD45G)
   05222 Small cell lung cancer
    109563283 (GADD45G)
   05223 Non-small cell lung cancer
    109563283 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109563283 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109563283 (GADD45G)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     109563283 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     109563283 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 109563283
NCBI-ProteinID: XP_019822186
Position
8
AA seq 159 aa
MTLEELRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGTGDESGAPVDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPNITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaacttcgtggccaggacacggttccagaaagcacagccaggatgcag
ggcgccgggaaagcgttgcacgagctgctgttgtcggcgcagcgccaaggctgcctcacg
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgc
gtgctagccgctgacgaggaggacgagggcgatatcgcgctgcagatccacttcactttg
atccaagcgttctgctgtgagaacgacatagacatcgtgcgcgtgggcgacgtgcagcgg
ctggcggcgatcgtgggtaccggcgacgagtcgggggcacctgtagacctgcactgtatc
ctcatttcgaaccccaatgaggacgcatggaaggaccccgccttggaaaagcttagcctg
ttctgcgaggagagccgcagcgtcaacgactgggtgcctaatatcacccttcccgagtga

DBGET integrated database retrieval system