KEGG   Bos indicus (zebu cattle): 109556235
Entry
109556235         CDS       T04792                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04024  cAMP signaling pathway
biu04137  Mitophagy - animal
biu04210  Apoptosis
biu04310  Wnt signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04530  Tight junction
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04668  TNF signaling pathway
biu04722  Neurotrophin signaling pathway
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04921  Oxytocin signaling pathway
biu04926  Relaxin signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05132  Salmonella infection
biu05133  Pertussis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05161  Hepatitis B
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05224  Breast cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109556235 (JUN)
   04012 ErbB signaling pathway
    109556235 (JUN)
   04310 Wnt signaling pathway
    109556235 (JUN)
   04668 TNF signaling pathway
    109556235 (JUN)
   04024 cAMP signaling pathway
    109556235 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109556235 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    109556235 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109556235 (JUN)
   04530 Tight junction
    109556235 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109556235 (JUN)
   04621 NOD-like receptor signaling pathway
    109556235 (JUN)
   04625 C-type lectin receptor signaling pathway
    109556235 (JUN)
   04660 T cell receptor signaling pathway
    109556235 (JUN)
   04658 Th1 and Th2 cell differentiation
    109556235 (JUN)
   04659 Th17 cell differentiation
    109556235 (JUN)
   04657 IL-17 signaling pathway
    109556235 (JUN)
   04662 B cell receptor signaling pathway
    109556235 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109556235 (JUN)
   04915 Estrogen signaling pathway
    109556235 (JUN)
   04921 Oxytocin signaling pathway
    109556235 (JUN)
   04926 Relaxin signaling pathway
    109556235 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109556235 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109556235 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556235 (JUN)
   05203 Viral carcinogenesis
    109556235 (JUN)
   05231 Choline metabolism in cancer
    109556235 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109556235 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109556235 (JUN)
   05211 Renal cell carcinoma
    109556235 (JUN)
   05224 Breast cancer
    109556235 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109556235 (JUN)
   05321 Inflammatory bowel disease
    109556235 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    109556235 (JUN)
   05031 Amphetamine addiction
    109556235 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109556235 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109556235 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109556235 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109556235 (JUN)
   05135 Yersinia infection
    109556235 (JUN)
   05133 Pertussis
    109556235 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109556235 (JUN)
   05170 Human immunodeficiency virus 1 infection
    109556235 (JUN)
   05162 Measles
    109556235 (JUN)
   05161 Hepatitis B
    109556235 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109556235 (JUN)
   05169 Epstein-Barr virus infection
    109556235 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109556235 (JUN)
   05142 Chagas disease
    109556235 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109556235 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109556235 (JUN)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    109556235 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 109556235
NCBI-ProteinID: XP_019812931
Position
3
AA seq 335 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGS
LSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMP
GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS
TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg
aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc
ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctaatc
atacagtccagcaacgggcatatcaccaccacgccgacccctacccagttcctgtgcccc
aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg
ggcctggtggccccggcggtggcctcggtggcgggcggcagcggcagcggtggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggctcg
ctgagcagcggcggcggggcgccctcctacggcgcggctggcctggcctttcccgcgcag
ccccagcagcagcagcagcaaccgccgcagccgccgcaccacctgccccagcagatcccc
gtgcagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgccc
ggggaaacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggag
aggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagagg
atcgcgcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtcc
acggccaatatgctcagggaacaggtggcccagcttaaacagaaagtcatgaaccacgtt
aacagcgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system