KEGG   Bos indicus (zebu cattle): 109556241
Entry
109556241         CDS       T04792                                 

Gene name
C8B
Definition
(RefSeq) complement component C8 beta chain
  KO
K03998  complement component 8 subunit beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05146  Amoebiasis
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109556241 (C8B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109556241 (C8B)
  09164 Neurodegenerative disease
   05020 Prion disease
    109556241 (C8B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556241 (C8B)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin DUF1869
Other DBs
NCBI-GeneID: 109556241
NCBI-ProteinID: XP_019812940
Position
3
AA seq 590 aa
MKTSRTWAWRVPAELFLLCAALGSFSVPSSRGERPPXLGSNAVNESLAKTRQTRSVDVTP
LPIDCELSSWSSWTTCDPCQKKRYRHAYLIRPSQFHGEQCNFSDKEVEDCVSNRPCRSQV
RCEGFVCAQTGRCINRRLLCNGDNDCGDQSDEANCRKTYKKCQQEMEQYWAIGSLASGIN
LFTNNLEGPVLDHRYYAGLCSPHYILNTRFRKPYNVENFIPQTRGKYDFTLTEYESYSDF
EHNVTGTAISKSSFSLGFKIAGIFELGYSSMSNIGQHFISRIKRFSHTKSKFLHARSDLE
VAHYKLKTRNLMLHHEFLQRVKQLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLIM
NKEAMDRGDYSLKNIHDCAKHDFKIGAAITSVYLKLGVSEAKCSDILNEIKDRNKKDSMV
KDLVVLVRGGASEYVTALAYKELPTADLMQEWGDAVQYNPDIIKVKVMPLYELVTATDFA
YSSTVKQNMKKALEEFQKEVDSCQCAPCQGNGVPVLKGTRCECICPAGFQGSACEVTHRK
NVPIDGKWNCWSNWSPCSGGHKTRQRQCTNPPPGNGGNPCSGPASETLNC
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaagacctccaggacatgggcttggagggtaccggcagagctgtttcttctctgtgct
gccctgggatctttcagtgtgcccagctccagaggtgaaaggccacccyctcttgggtca
aatgcagtcaatgagagccttgccaagackagacagacgcggagtgtggatgtcacgccg
ttgcctattgattgcgagctgtccagctggtcttcctggaccacgtgtgatccctgtcag
aagaaaaggtacagacatgcctacttgatccggccctctcagttccatggggaacaatgc
aacttctccgacaaagaagttgaagactgtgtttccaatagaccrtgcagaagtcaagtg
cgatgtgaaggctttgtgtgtgcacagacagggaggtgcataaaccgaagacttctttgc
aatggggacaatgactgtggagaccagtcagatgaggcgaactgtagaaagacttataaa
aaatgtcagcaggaaatggagcaatactgggccattggcagcctggccagtgggattaat
ttgttcacaaacaacttggagggcccagttctagatcataggtattatgccggtctgtgc
tccccgcattacatactcaacacraggtttcggaagccatacaacgtggaaaacttcatt
ccacagacccgaggcaaatatgactttacgttgacagaatatgaatcgtactcagatttt
gaacataacgtcacagggacggcaattagcaagtctagtttcagcttgggtttcaaaatt
gctggaatatttgaacttggctacagcagcatgagtaatattggccaacattttattagc
aggatcaaacgattctctcatacgaaaagcaaattcctgcacgcacgctctgaccttgaa
gtagcgcattacaagctgaaaaccagaaacctcatgctgcatcacgaattccttcagcga
gtcaagcagctgcccttggaatacagctatggggagtacagagatctcttccgtgatttt
ggaacccactacatcacagaggctgtgcttgggggcatttatgaatayacactcatcatg
aacaaagaggcgatggacagaggagattactctcttaagaacatccacgactgtgctaaa
catgattttaaaatcggcgccgccataacatcggtctacttgaagctgggtgtgtcggag
gccaagtgcagtgacattctcaatgagataaaagacagaaacaagaaagacagcatggtg
aaagacttggtggtccttgtacgaggaggagcgagtgagtatgtcactgccctggcatac
aaagagctgccaacagcggacctgatgcaagaatggggagatgcagtgcagtacaatccg
gacatcatcaaagttaaggtaatgcctctgtatgaactggtgacagccacagactttgcc
tattccagcacagtgaagcagaacatgaagaaggccctggaggagttccagaaggaagtc
gactcctgccagtgtgctccctgccaggggaacggagtccctgttctgaaaggaacacgc
tgtgagtgcatctgtcccgctggattccaaggctcggcctgtgaggtcacacaccggaaa
aatgtccccattgatgggaagtggaattgctggtcaaactggtctccgtgttctggagga
cataaaacaagacaaaggcagtgcaccaatccacctcctggaaatgggggcaacccctgc
tcgggtcctgcttcagaaacacttaactgttaa

KEGG   Bos indicus (zebu cattle): 109556242
Entry
109556242         CDS       T04792                                 

Gene name
C8A
Definition
(RefSeq) complement component C8 alpha chain
  KO
K03997  complement component 8 subunit alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05146  Amoebiasis
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109556242 (C8A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109556242 (C8A)
  09164 Neurodegenerative disease
   05020 Prion disease
    109556242 (C8A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556242 (C8A)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 109556242
NCBI-ProteinID: XP_019812941
Position
3
AA seq 589 aa
MFAAAFFLLFLMTYQPGVTIQEKVNWRVSRAVQSFTPTAVSCQLDNWAEWTDCFPCQDKK
YRYRSLLQPNKFGGTICSGNVWDQASCHSPTACLSQAQCGQDFQCKETGRCLKRHLVCNG
DKDCLDGSDEDDCEDVRILENDCSQYDPIPGSEKAALGYNILTQEEAQHVYDARYYGGQC
EXVYNGEWRELQYDPACERLYYGDDDKYFRKPYNFLKYHFEAQADTKISSEIYNDANDLL
TKVKNDKSVSSGLTIGVGIRGVPVTVTAGVSMSXDAAFLKKLSKYHEKKYSFMRIFTKVQ
TAHFKMRRENIVLDEGMLQSLMELPERYHYGMYAKFINDYGTHYITSGSMGGVYEYIMVL
NREKMETAGVTSAEIQKCFGVSLGIEYEYSEAIQIKGSSSLGPCKKSGDGKLTENEKAMG
VEDFISRVRGGSSGWGGSLTQDSSLVTYRSWGRSLKYNPAVIDFEMKPIHEILQHTNLGS
LETKRQNLRRALDKYLMEFNACRCGPCFNNGEPILEGTSCKCQCPVGHQGLACEQMQSEG
AQADGRWSCWSSWSACRSGTQERRRECNNPAPQNGGASCPGHRVQTQAC
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgtttgctgctgcttttttcctcttatttttgatgacttatcagcctggggtaaccata
caggagaaggtgaactggagagtcagtcgagctgttcagagtttcacccccacagcggtc
tcctgccagctggacaactgggcagagtggacagactgctttccatgccaggacaaaaag
tacagataccggagcctcttgcagccaaacaagtttgggggaaccatctgcagtgggaat
gtctgggaccaagccagctgtcacagtcccacagcttgtctgagtcaagcacagtgtgga
caggatttccagtgtaaggagacaggtcgctgcctgaaacgccacctggtgtgtaatgga
gacaaggactgcctggacggctctgacgaggatgactgtgaagacgtcaggatcttggaa
aatgactgcagccagtatgacccaattccaggatcagagaaggcggccttggggtataat
atcctgacccaggaagaagctcagcatgtgtatgatgccaggtactacgggggccagtgt
gagaykgtatacaatggggaatggagggagcttcagtatgaccctgcctgtgagcgtctc
tactacggagatgatgataagtacttccggaaaccctacaatttcctgaaatatcacttt
gaagcccaggcagatactaaaatctcttcagagatatataatgatgcaaatgatcttctt
actaaagtaaaaaatgacaagtctgtgtcaagtggattgaccattggtgtgggcattaga
ggcgtcccagtcacggtgactgcaggtgtatccatgtcamaagatgctgccttcttaaaa
aagttaagcaagtatcatgagaagaaatacagctttatgagaattttcacaaaggtgcag
actgctcattttaagatgaggagggaaaacatcgtgctggatgaaggtatgctgcagtca
ctaatggagcttccagagcgataccactatggcatgtacgccaarttcatcaatgactac
ggcacccattacataacgtctggatcgatgggtggtgtctatgagtatatcatggtgctt
aacagagaaaaaatggaaacagctggtgttaccagcgctgaaatccagaaatgctttgga
gtctctttgggcattgagtatgagtattcagaggcgatacaaattaaaggaagttcatca
ttaggaccctgtaaaaaatctggagatggcaaactaactgaaaacgagaaggccatggga
gtggaagacttcatttctcgggtgcgcggcggcagctctggctggggaggcagcttgacc
caggacagcagcctcgttacgtaccgctcctgggggaggtcattaaagtataatcctgct
gttattgattttgagatgaagccaatccatgagatactgcagcacacgaacctggggtcc
ctggagaccaagcgccagaacctgcggcgggccctggacaagtacctgatggaattcaac
gcctgccgctgtgggccctgcttcaacaatggggagcccatccttgagggtaccagctgc
aagtgtcagtgccccgtgggtcaccagggccttgcctgtgagcaaatgcagtcagaggga
gctcaggcggatggtcgttggagctgctggagctcctggtctgcttgcagatcgggcacc
caggagaggaggagagagtgtaacaatcccgcaccycagaacggaggtgcctcgtgtcca
ggccacagggtgcagacccaggcatgctga

KEGG   Bos indicus (zebu cattle): 109566624
Entry
109566624         CDS       T04792                                 

Gene name
C8G
Definition
(RefSeq) complement component C8 gamma chain isoform X1
  KO
K03999  complement component 8 subunit gamma
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05146  Amoebiasis
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109566624 (C8G)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109566624 (C8G)
  09164 Neurodegenerative disease
   05020 Prion disease
    109566624 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109566624 (C8G)
SSDB
Motif
Pfam: Lipocalin Coleoptericin
Other DBs
NCBI-GeneID: 109566624
NCBI-ProteinID: XP_019826719
Position
11
AA seq 255 aa
MECTVRRSLQARILGCLFLLQGIFPTQGSNPVLPRCRWTQSHLVDKDQRSTWTLDTGHGD
RPLPGSAGPSSLGQRVRRPPRPPSPISTIQPKANFDAQQFSGTWLLVAVASPCRYLQEQG
HRAEATTLHVAPQGSAMVVSTFRKLDGICWAVRQLYGDTGRPGRFLLQARGARGPVDVVV
GDTDYRGFAVLYLERARQLSVKLYVRSLPVSDSFLSVFEQRVQGANLTEDHTLFFPKYGF
CEAADQFHTLDEVRR
NT seq 768 nt   +upstreamnt  +downstreamnt
atggagtgtacagttcgtcgcagtctccaagcaagaatcctgggttgccttttcctcctc
caggggatcttcccgacccagggttcaaacccggttctcccgcgttgcaggtggactcag
agccacctggtggacaaagaccagaggtcaacttggactttggacaccggacatggcgac
cggcccctgccgggaagcgcagggccaagctccctgggtcagcgggtgcggagacccccg
cggcccccatcccctatcagcaccatccagcccaaggccaactttgacgcccagcagttc
tcagggacctggctcctggtggccgtggcctccccatgtcgctacctgcaggagcagggc
catcgggctgaggccactactctgcacgtggctcctcagggctcagccatggttgtcagc
accttccgaaagctggatggaatctgctgggcagtgcggcagctgtacggagacacggga
cgcccagggcgcttcctgctccaagcccggggcgcccgcgggccggtggacgtggtcgtc
ggggacacggactaccgcggctttgccgtcttgtacctggagagggcgcggcagctgtcg
gtgaagctgtacgtccgctcgctccctgtgagcgattccttcctgagtgtgtttgagcag
cgggtccagggggccaacctgaccgaggaccacaccctgttcttccccaagtacggtttc
tgcgaggccgcggaccagttccacaccctggacgaagtacggaggtga

KEGG   Bos indicus (zebu cattle): 109574935
Entry
109574935         CDS       T04792                                 

Gene name
C7
Definition
(RefSeq) complement component C7
  KO
K03996  complement component 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109574935 (C7)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109574935 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    109574935 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi Ldl_recept_a TSP_1
Other DBs
NCBI-GeneID: 109574935
NCBI-ProteinID: XP_019838524
Position
20
AA seq 843 aa
MKAITLFFLVGFIGEFQVFSSASSPINCQWGSYAPWSECNGCTKTQTRRRSIAVYGQYGG
HSCVGSAFETQPCQPTRGCPTEDGCGERFRCFSGQCISKSLVCNGDSDCEEDGADEDRCE
DAESRPACDKDKPPPNIELTGRGYNALTGQFRNQVLNTKSFGGQCRKVYSGDGRXFYRLS
GNILSYTFQVKINNDFNNEFYNSTWAYVKETSTEHSSSSKGRFLFFSSSSSSHGYSSNTN
ILTKKKSYQLLVLQNTVEVAQFINNNPEFLQLAESFWKELSYLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYKVIFHMDSEKVKKFDFHSEDKRKCASSHFQFLFTSSKQKCTTMEEVL
KSVSENEGNLLRGVPFVRGGHSGFLAGLSYLDLNNPAGNKRRYSQWAGSVPDLPEVIKQK
LTPLYELVKEVPCASVKKLYLKRAIEEYLDEFDPCHCRPCHNGGMATVQGSQCQCYCKPK
TSGVACEQGVLLGDQAGGVDGGWNCWSSWGPCVQGKKTRSRQCNNPPPSGGGKSCVGETS
ETRQCEDEELEHLRLLEPHCFPLSLVPTKFCSSPPALKDGFVQDEGATFPVGKNIMYTCK
EGYSLVGDPVARCGEDLQWLVGNMHCQKIACVLPALMDGIQSHPHKPFYTIGEKVTISCS
GGRSLEGPSTFLCSSSLKWSPEVKDVQCVQREAPLTPKVPKCQPWEKLQNSRCVCKMPYE
CGSSLGVCARDERSKRILPLTVCKMHVLQCQGRNYTVAGRESCTLPASAEKACGVCPLWE
KCDAEGSECVCRAASECEEAGFSVCVEVNGREQTMTECEAGVLRCRGLSISVTGIRPCAA
EAA
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgaaggcaataactttattcttcttggtgggatttataggagagtttcaagttttttca
agtgcctcctcgccaatcaactgccaatggggttcttatgctccttggtcagaatgcaat
ggttgtaccaagactcagactcgcaggcggtcaattgctgtttatggacaatacggcggc
cattcctgtgtgggaagtgcttttgaaacacaaccatgtcaacctactcgaggatgtcca
acagaagacggatgtggagaacgtttcaggtgtttctcaggtcagtgcatcagcaaatct
ttagtttgcaatggggattctgactgtgaagaggacggtgctgatgaagacagatgcgag
gatgcagaaagcagacctgcctgtgacaaggataaacctcctccaaacatagagcttacc
ggacgtggttacaatgcactaacgggccagtttagaaaccaagtcctcaataccaaaagt
tttggtggtcaatgcagaaaggtgtatagtggggatgggagagrtttctacagactgagt
ggaaatatcctctcctacacattccaggtgaaaataaataatgattttaataatgaattt
tataatagtacctgggcttatgtaaaagagacatcaacagaacattcatcatctagtaaa
ggacgtttcctcttttttagttcttcatcttcttcacacggttactcttcaaatacgaat
atactcactaagaaaaagagttatcaattgttggttcttcagaacactgttgaagtggct
cagtttatcaataacaatccggaatttttacaactggctgagtcattctggaaggaactc
tcttaccttccctctctgtatgactacagtgcctaccgaagattgattgaccagtatggg
acgcattatcttcagtctgggtccttaggaggagaatacaaagttatctttcatatggac
tcagaaaaagtcaaaaaatttgatttccattcagaggacaagaggaaatgtgcttcctca
catttccagtttttgtttacatcatcaaaacaaaaatgcacaacgatggaagaggtctta
aaatcggtttcagaaaatgagggcaatttgttgcgaggggtcccatttgtcagaggagga
cattctggcttcttggctggccttagttacctggatctgaacaatcctgctggaaacaaa
cggcgatattctcagtgggcaggatctgtacctgatcttcctgaagtcataaaacaaaag
ctaacgcctttgtatgaactggtcaaggaagtaccctgtgcctctgtgaaaaagctctac
ctgaaacgggccatcgaggagtacctggatgaatttgacccctgccattgccggccttgt
cacaatggtggcatggccactgttcagggaagccagtgtcagtgctactgcaaaccgaaa
acgtctggtgtggcgtgtgagcaaggcgtcctcttaggggaccaagcaggaggggtggat
ggagggtggaactgctggtcctcttggggtccctgtgttcaagggaagaaaacaagaagc
cgacaatgcaataacccgcctcccagtgggggtgggaaatcctgcgttggagaaacctca
gaaaccaggcaatgcgaagacgaggagctggagcatttgcgattgctcgaaccacattgt
tttcccttgtctttggttccaacaaaattctgttcatcacctcctgccttgaaagacgga
tttgttcaagatgaaggtgccacatttcctgttgggaaaaacataatgtatacttgcaaa
gaaggatactctctggttggagaccctgttgccagatgtggagaagatttgcagtggctt
gttgggaatatgcattgtcagaaaattgcctgcgttctgcctgcactgatggatggcata
cagagtcatccccacaaacctttctacaccattggcgagaaggtgaccatttcctgttca
ggcggcagatccttagaaggtccctcgacatttctctgtagttccagccttaagtggagc
cctgaggtaaaggatgtccagtgtgtgcagagagaagcacctttgacaccgaaagtgcct
aaatgtcagccctgggagaaactgcagaattcaagatgtgtttgtaaaatgccctatgaa
tgtgggtcctcattgggtgtatgtgctcgagatgagagaagcaaaaggatactgcctctg
accgtttgcaagatgcacgttctccagtgccagggtagaaattacaccgtggctggtagg
gagagctgcactctgcctgcctcggctgaaaaagcttgcggtgtgtgtccactatgggaa
aaatgtgatgccgagggcagcgaatgtgtctgcagagccgcctcggagtgcgaggaagca
ggatttagcgtctgcgtagaggtgaacggcagggagcagacgatgaccgagtgcgaggcc
ggcgtcctgagatgcagaggactgagcatctccgtcacaggcatccggccctgcgccgcc
gaggccgcgtag

KEGG   Bos indicus (zebu cattle): 109574958
Entry
109574958         CDS       T04792                                 

Gene name
C9
Definition
(RefSeq) complement component C9
  KO
K04000  complement component 9
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05146  Amoebiasis
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109574958 (C9)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109574958 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    109574958 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109574958 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 109574958
NCBI-ProteinID: XP_019838570
Position
20
AA seq 548 aa
MSAGQRFAFAICILEISLLRAGPTPSYDPAERQGTPLPIDCRMSSWSEWSKCDPCLKQMF
RSRSIEIFGQFNGRKCVDAVGDRQQCVPTEACEDPEEGCGNDFQCGTGRCIKNRLLCNED
NDCGDYSDEDNCEQDPRPPCRNRVVEESELARTAGFGINILGMDPLSTPFDNQYYNGLCD
RVWDGNTLTYYRRPWNVASLTYDTKADKNFRTENHEESIQILRTIIEEKKLNFNAGLXVK
YTPVEAIEKNKCVDLEHSDKGSISSPSKLAAEATFRFAYSKDDIYRLLSSYSAKQEKMFL
HVKGKVHLGRFVMRSRDVMLQTTFLDSINTLPTTYEKGEYFAFLETYGTHYSSSGSLGGL
YELIYVLDKKSMEQKDIELRDVQRCLGFDLDLSLKVGVEVTGNFDSKLCSKKGMGQTETN
PEADLFDDVITFIRGGTRKYATELKEKLLRGARMINVTDFVNWAASLNHAPVLISQKLVP
IYDLIPVKMKDAHLKKQNLERAIEDYINEFSVRKCQPCQNGGTVVLLDGECVCSCPKEFK
GVACEIKK
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgtctgccggccagaggttcgcctttgcaatatgcattctagaaataagtctcctgaga
gcggggcccactcccagctacgacccagcagaaagacaaggcacaccattgcccatagac
tgcaggatgagctcctggagtgagtggtcgaaatgtgacccttgcctcaaacaaatgttt
cgttcaaggagcattgagatctttggacaatttaatgggcgaaagtgtgtggacgccgtg
ggagaccgacagcagtgtgtacccacagaggcctgcgaagaccccgaggagggctgtggc
aacgatttccagtgcggtacaggcagatgcataaagaatcgacttctgtgtaatgaagac
aatgactgcggagactattcagatgaggataactgtgaacaggatcctcgtcccccttgc
cgcaaccgagtggtggaagagtcagagctggcacggacggcaggatttgggatcaacatc
ttaggcatggatccgctcagcaccccttttgacaaccagtactacaatggactctgtgac
cgagtttgggacggcaacaccttgacgtactaccgcaggccctggaacgtggcttcgctg
acctatgacaccaaagctgacaagaatttcagaactgaaaatcatgaagaaagcattcag
atactcagaactattatcgaagagaagaaattaaattttaatgcaggtttaastgtaaaa
tatacacctgttgaagcaattgaaaagaataaatgtgtagatttagaacattctgacaaa
ggaagcatctcaagtccttccaagttggctgctgaggctacgtttcgatttgcatattcc
aaagatgatatttacagactgttgtcgtcatattctgctaagcaggaaaaaatgtttctg
catgtaaaagggaaagttcacctgggaagatttgtgatgagaagtcgggatgtcatgctg
caaacaactttcttggattctataaatactctgccgactacttacgaaaagggggaatat
tttgcatttttggaaacctatggaacccactacagtagctctgggtctcttggaggactc
tatgaactaatatatgttttggataagaagtccatggagcagaaagatattgaactgagg
gacgtacagagatgcctcgggtttgatctggatttgtctctgaaggttggagttgaagtt
acgggaaattttgattcaaaactttgctcaaagaagggtatgggtcaaacagaaacgaac
ccagaggctgacctcttcgatgatgttattaccttcataagaggaggaaccagaaaatac
gcaactgaactgaaagagaaacttctcagaggagccagaatgatcaatgtgactgacttt
gtaaattgggccgcttccttaaatcatgctccggtgctcataagccaaaaactagttccg
atatatgatctgattccagtgaaaatgaaagatgcacacctcaagaaacaaaatttggaa
agagccattgaagactacatcaatgaattcagtgtaagaaaatgccaaccgtgccaaaat
ggagggactgtggttctgctggacggagaatgtgtgtgttcctgcccaaaagagttcaag
ggagttgcctgtgaaataaaaaaatag

KEGG   Bos indicus (zebu cattle): 109574981
Entry
109574981         CDS       T04792                                 

Gene name
C6
Definition
(RefSeq) complement component C6
  KO
K03995  complement component 6
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109574981 (C6)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109574981 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    109574981 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a Kazal_3
Other DBs
NCBI-GeneID: 109574981
NCBI-ProteinID: XP_019838608
Position
20
AA seq 932 aa
MARHSVLYFILLSALIDKSQACFCDHYPWSQWSSCSKTCNSGTQTRQRRIVTDKYYFENF
CGQLCTKQESRECNWQTCPINCRLGDYGPWSDCDPCVQKRFKVRSILRPSQFGGQPCTEP
LMTFQPCIPSKLCKIEEIDCKNKFRCDSGRCIASKLECNGENDCGDNSDERNCGRKKTVC
SRSHNPIPGVQLMGMGFHFLAGEPRGEVLDNSFTGGVCRTVKSSRASNPYRVPANLENVN
FEVQTKEDDLEADFYDDLIPLEDNKDQEALGSGLATSSFRVPIFYSSKRSQSSSHSSAFK
QAIQASQKKASSFIRIHKVIKVLNFTMKTKDLQLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSKEELKNSGLTQEEAKNCIRIETKKRFLFVKKTKVEHRC
TTNKLSEKYEGSFMQGSEKSISLVQGGRSAYAAALAWEKGSPVPEERVFSDWLESVKENP
SVIDFALAPITDLVRNIPCAVTRRNNLRRAFREYAAKFDPCQCARCPNSGRPVLSGTECL
CVCQSGTYGENCERRSPDYKSNAVDGNWGCWSSWSSCDATYRRSRTRECNNPAPQQGGKR
CEGERRQEEHCTFSIMQNDGQPCISDDEDMKETDLPELESDSGCPQPVPPENGFIRNEKK
QYSVGEEVEILCFTGFKAVGYQYFRCLPDRSWRQGDVECQRTECLKPIVPEGLTLSPFQT
LYKIGDSIELTCPRGLVVNGPSRYTCSGDSWTPPISDSLSCEKDVLTGLRGHCQPGQKQL
GSECVCMSPEEDCGHYSEEICVLDTTSSDYFTSSACKLLAEKCLNNQQLHFVHIGSCEEG
PQLKWGLERIKLSSSSTKNESCGYDTCYNWEKCSATTSKCVCLLPSQCTKGGDQLFCVQI
GSSANGKTMNICEVGAVKCAKREMEILHSGRC
NT seq 2799 nt   +upstreamnt  +downstreamnt
atggccagacactccgtcttgtattttatcctgctgagtgctctaattgacaagagccaa
gcctgtttctgtgatcattacccatggagtcagtggtccagctgctcaaaaacctgcaat
tctggaacccagaccagacagagacggattgttacagataagtactattttgaaaacttt
tgtggccagctttgtaccaagcaggagtccagagaatgtaactggcaaacttgccctatc
aattgccgcctgggagattatggaccctggtcagactgcgacccttgtgttcaaaaacgg
ttcaaggttaggtccatcctgcgccccagtcagtttggaggacaaccatgtacggagcct
ctcatgacctttcagccgtgcattccatccaagctctgcaaaattgaggagattgactgc
aagaataaattccgctgtgacagtggtcgctgcattgccagcaagttggaatgcaatgga
gaaaatgattgtggagacaattcagatgaaaggaattgtggaagaaaaaaaacagtatgt
tcacggagccataatcccatccctggtgtacagttgatgggcatggggtttcatttcctg
gcaggagagcccagaggagaagtccttgataactctttcactggaggagtgtgtagaact
gtcaaaagcagtagagcaagtaatccataccgtgttccggccaatctagaaaatgtcaac
ttcgaggtgcaaactaaagaagatgatttggaagcagatttctacgacgatttaattcct
cttgaagataataaagatcaagaagccttaggttctggcctagcaacgagctcttttcgt
gtacccattttctattcctcaaagagaagtcaaagcagctcccattcttctgccttcaaa
caagccattcaagcctcccaaaaaaaggcttccagttttattaggatccataaagtcata
aaagtcttaaacttcacaatgaaaactaaagatctgcagctttctgatgtcttcttgaaa
gcacttaaccatctgcctctagaatacaactctgctttatacagccggatctttgatgac
ttcgggactcactatttcacctctggctccctgggaggcgtgtacgacctcctttatcag
tttagcaaggaggaactaaagaactcaggtttaacacaggaagaagccaaaaactgtatc
cggattgaaacaaagaaacgcttcctttttgttaaaaaaacaaaagtggaacaccggtgc
accactaacaaactgtcagagaaatacgaaggttcctttatgcagggatcagagaaatcc
atatcgctggttcaaggtgggaggagcgcatatgcggcggctttggcttgggagaaaggg
agcccggttccggaagagagggtattttctgactggttagaatcagtgaaggaaaatcct
tctgtgatcgactttgcgcttgctcccatcacggacctggtgagaaacatcccctgtgcg
gtgacaagacggaacaacctcaggagagcttttcgagagtatgcagccaagtttgaccct
tgccagtgtgcccgatgccctaacagtggccgccccgtgctctcagggaccgaatgtctg
tgtgtttgccagagcggcacctatggcgagaactgtgagagacggtccccggattacaaa
tctaatgctgtggacgggaactggggctgctggtcctcctggagctcgtgtgatgctact
tataggagatcgagaacccgcgaatgcaacaaccctgctcctcagcaaggaggaaaacgc
tgtgagggggagaggcggcaagaggagcactgcacgttctccataatgcagaacgatgga
caaccatgcatcagtgatgatgaggacatgaaagaaactgatctccctgaattagaatca
gattcagggtgtcctcaaccagtccctccagaaaatggatttattcggaatgaaaagaaa
cagtactcagttggagaagaagttgaaattttatgctttactggattcaaagctgttgga
taccagtacttcagatgcttaccagacagaagctggaggcaaggagacgtggaatgccaa
cggacagagtgcctcaagccaatagtgccagaaggactgacgctgtcaccatttcagaca
ttatataaaattggtgactccattgagctgacctgtcccagaggtttggttgtcaatggg
ccatcaaggtacacatgcagtggggattcctggacaccacccatttcggactcactcagc
tgtgaaaaagatgtcctgacaggcttaaggggtcactgtcaaccaggacaaaaacagttg
ggatctgaatgcgtttgcatgtctccagaagaagactgtggccattattcagaagaaatc
tgtgtgcttgatacaacatccagcgattactttacttcatctgcttgtaagcttttggct
gagaaatgtttaaataatcagcaactccattttgtacatattggttcatgcgaagagggt
ccacagttaaaatggggtctggaaaggataaaactttcatccagtagcacaaagaatgaa
tcctgtggctatgacacctgctacaactgggaaaaatgttcagccaccacctccaagtgt
gtctgcctgttaccctcccagtgcaccaagggcggagaccaactcttctgcgtccaaata
ggatcatcagcgaatgggaaaacaatgaacatatgtgaagtaggagctgtaaaatgtgcc
aaaagggaaatggaaatactgcattctgggaggtgttaa

DBGET integrated database retrieval system