KEGG   Bos indicus (zebu cattle): 109556290Help
Entry
109556290         CDS       T04792                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00480  Glutathione metabolism
biu00590  Arachidonic acid metabolism
biu01100  Metabolic pathways
biu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109556290 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109556290 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    109556290 (GPX7)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109556290 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 109556290
NCBI-ProteinID: XP_019813027
Position
3
AA seq 186 aa AA seqDB search
MVAARAAAWLLLAAAACAPREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTETSGKEPTWNFWKYLVAPDGKVIGAWDPTVSVEEIRPQITALVRKLIL
KKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcacgggcggcggcgtggctgctcctggctgcggcggcctgcgcgccgcgg
gagcaggacttctacgacttcaaggccgtcaacatccggggcaagttggtgtcgctggag
aagtaccgaggctcggtgtccctggtggtgaacgtggctagcgagtgtggcttcacagac
cagcactatcgggccctgcagcagctgcagcgggacctggggccccaccacttcaatgtg
cttgccttcccctgcaaccagtttggccagcaggagcccgacagcaacaaggagatcgag
agctttgcccgccgcacatacagtgtctctttccccatgtttagcaagattgcagtcacc
ggcactggtgcccaccctgccttcaagtacctgactgagacttctgggaaggagcctacc
tggaacttctggaagtacctggtggccccagatggaaaggtgataggagcttgggaccca
actgtgtcggtggaggaaatcaggccccagattacagcgcttgtgaggaaactcatcctg
aagaagcgagaagacttataa

DBGET integrated database retrieval system