KEGG   Bos indicus (zebu cattle): 109556345
Entry
109556345         CDS       T04792                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05142  Chagas disease
biu05146  Amoebiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109556345
   04014 Ras signaling pathway
    109556345
   04015 Rap1 signaling pathway
    109556345
   04370 VEGF signaling pathway
    109556345
   04630 JAK-STAT signaling pathway
    109556345
   04668 TNF signaling pathway
    109556345
   04066 HIF-1 signaling pathway
    109556345
   04068 FoxO signaling pathway
    109556345
   04070 Phosphatidylinositol signaling system
    109556345
   04072 Phospholipase D signaling pathway
    109556345
   04071 Sphingolipid signaling pathway
    109556345
   04024 cAMP signaling pathway
    109556345
   04151 PI3K-Akt signaling pathway
    109556345
   04152 AMPK signaling pathway
    109556345
   04150 mTOR signaling pathway
    109556345
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109556345
  09143 Cell growth and death
   04210 Apoptosis
    109556345
   04218 Cellular senescence
    109556345
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109556345
   04550 Signaling pathways regulating pluripotency of stem cells
    109556345
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109556345
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109556345
   04620 Toll-like receptor signaling pathway
    109556345
   04625 C-type lectin receptor signaling pathway
    109556345
   04650 Natural killer cell mediated cytotoxicity
    109556345
   04660 T cell receptor signaling pathway
    109556345
   04662 B cell receptor signaling pathway
    109556345
   04664 Fc epsilon RI signaling pathway
    109556345
   04666 Fc gamma R-mediated phagocytosis
    109556345
   04670 Leukocyte transendothelial migration
    109556345
   04062 Chemokine signaling pathway
    109556345
  09152 Endocrine system
   04910 Insulin signaling pathway
    109556345
   04923 Regulation of lipolysis in adipocytes
    109556345
   04929 GnRH secretion
    109556345
   04915 Estrogen signaling pathway
    109556345
   04914 Progesterone-mediated oocyte maturation
    109556345
   04917 Prolactin signaling pathway
    109556345
   04926 Relaxin signaling pathway
    109556345
   04935 Growth hormone synthesis, secretion and action
    109556345
   04919 Thyroid hormone signaling pathway
    109556345
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109556345
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109556345
  09156 Nervous system
   04725 Cholinergic synapse
    109556345
   04722 Neurotrophin signaling pathway
    109556345
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109556345
  09158 Development and regeneration
   04360 Axon guidance
    109556345
   04380 Osteoclast differentiation
    109556345
  09149 Aging
   04211 Longevity regulating pathway
    109556345
   04213 Longevity regulating pathway - multiple species
    109556345
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556345
   05206 MicroRNAs in cancer
    109556345
   05205 Proteoglycans in cancer
    109556345
   05203 Viral carcinogenesis
    109556345
   05230 Central carbon metabolism in cancer
    109556345
   05231 Choline metabolism in cancer
    109556345
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109556345
  09162 Cancer: specific types
   05210 Colorectal cancer
    109556345
   05212 Pancreatic cancer
    109556345
   05225 Hepatocellular carcinoma
    109556345
   05226 Gastric cancer
    109556345
   05214 Glioma
    109556345
   05221 Acute myeloid leukemia
    109556345
   05220 Chronic myeloid leukemia
    109556345
   05218 Melanoma
    109556345
   05211 Renal cell carcinoma
    109556345
   05215 Prostate cancer
    109556345
   05213 Endometrial cancer
    109556345
   05224 Breast cancer
    109556345
   05222 Small cell lung cancer
    109556345
   05223 Non-small cell lung cancer
    109556345
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109556345
   05017 Spinocerebellar ataxia
    109556345
   05020 Prion disease
    109556345
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109556345
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109556345
   04932 Non-alcoholic fatty liver disease
    109556345
   04931 Insulin resistance
    109556345
   04933 AGE-RAGE signaling pathway in diabetic complications
    109556345
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109556345
   05100 Bacterial invasion of epithelial cells
    109556345
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109556345
   05170 Human immunodeficiency virus 1 infection
    109556345
   05162 Measles
    109556345
   05164 Influenza A
    109556345
   05161 Hepatitis B
    109556345
   05160 Hepatitis C
    109556345
   05168 Herpes simplex virus 1 infection
    109556345
   05163 Human cytomegalovirus infection
    109556345
   05167 Kaposi sarcoma-associated herpesvirus infection
    109556345
   05169 Epstein-Barr virus infection
    109556345
   05165 Human papillomavirus infection
    109556345
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109556345
   05142 Chagas disease
    109556345
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109556345
   01524 Platinum drug resistance
    109556345
   01522 Endocrine resistance
    109556345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109556345
Membrane trafficking [BR:biu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109556345
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Cupin_8 DUF5638 Fez1 PI_PP_I
Other DBs
NCBI-GeneID: 109556345
NCBI-ProteinID: XP_019813110
Position
3
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGIKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRKEGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYGSLKELVLHYQRTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaayacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagccattacaaatggaataaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattgcgg
gacatgccagatggtaccttcttggtcagagatgcctcaaccaaaatgcagggagattac
actttgaccttgcggaagggaggcaataataagctaataaagatttatcatcgagatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattagccactat
catcatgaatctcttgcccagtacaatcccaaacttgatgtgaaactgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataatattgatgctgtcgggaaaaaa
ctgcaggagtatcactctcagtatcaggaaaagagtaaagaatatgacagactatatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcatacacaagaacaacatagcaaagaatat
attgagcgattycgaaaagaagggaatgaaaaggaaattgaacgaattatgatgaattat
gacaagctgaaatcacgtctgggtgagattcatgatagcaaaatgcgtcttgaacaggat
ttgaagaaacaagctttggataaccgagaaatagataaaaaaatgaatagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtgtggctcaatcacaaagga
gtgagacagaagcgcctaaatgcctggctgggaatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaaccgagtacaagcagaggacttgctctatgggaaacctgacggtgcattc
ttaatccgtgagagtagcaagaaaggatgttatgcttgctctgtggtcgccgatggggag
gtgaagcactgcgtcatctacagcacygctcggggctacggcttcgcggagccctacaac
ctgtacggctccctgaaggagctggtgctccactaccagcggacgtccctcgtgcagcac
aacgactctctcaacgtcaggctcgcctaccctgtccacgcacagatgccctcgctctgc
agataa

KEGG   Bos indicus (zebu cattle): 109557823
Entry
109557823         CDS       T04792                                 

Gene name
PIK3CA
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00562  Inositol phosphate metabolism
biu01100  Metabolic pathways
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05100  Bacterial invasion of epithelial cells
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05142  Chagas disease
biu05146  Amoebiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109557823 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109557823 (PIK3CA)
   04014 Ras signaling pathway
    109557823 (PIK3CA)
   04015 Rap1 signaling pathway
    109557823 (PIK3CA)
   04370 VEGF signaling pathway
    109557823 (PIK3CA)
   04630 JAK-STAT signaling pathway
    109557823 (PIK3CA)
   04668 TNF signaling pathway
    109557823 (PIK3CA)
   04066 HIF-1 signaling pathway
    109557823 (PIK3CA)
   04068 FoxO signaling pathway
    109557823 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    109557823 (PIK3CA)
   04072 Phospholipase D signaling pathway
    109557823 (PIK3CA)
   04071 Sphingolipid signaling pathway
    109557823 (PIK3CA)
   04024 cAMP signaling pathway
    109557823 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    109557823 (PIK3CA)
   04152 AMPK signaling pathway
    109557823 (PIK3CA)
   04150 mTOR signaling pathway
    109557823 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109557823 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    109557823 (PIK3CA)
   04218 Cellular senescence
    109557823 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109557823 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    109557823 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109557823 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109557823 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    109557823 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    109557823 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    109557823 (PIK3CA)
   04660 T cell receptor signaling pathway
    109557823 (PIK3CA)
   04662 B cell receptor signaling pathway
    109557823 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    109557823 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    109557823 (PIK3CA)
   04670 Leukocyte transendothelial migration
    109557823 (PIK3CA)
   04062 Chemokine signaling pathway
    109557823 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109557823 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    109557823 (PIK3CA)
   04929 GnRH secretion
    109557823 (PIK3CA)
   04915 Estrogen signaling pathway
    109557823 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    109557823 (PIK3CA)
   04917 Prolactin signaling pathway
    109557823 (PIK3CA)
   04926 Relaxin signaling pathway
    109557823 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    109557823 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    109557823 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109557823 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109557823 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    109557823 (PIK3CA)
   04722 Neurotrophin signaling pathway
    109557823 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109557823 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    109557823 (PIK3CA)
   04380 Osteoclast differentiation
    109557823 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    109557823 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    109557823 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109557823 (PIK3CA)
   05206 MicroRNAs in cancer
    109557823 (PIK3CA)
   05205 Proteoglycans in cancer
    109557823 (PIK3CA)
   05203 Viral carcinogenesis
    109557823 (PIK3CA)
   05230 Central carbon metabolism in cancer
    109557823 (PIK3CA)
   05231 Choline metabolism in cancer
    109557823 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109557823 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109557823 (PIK3CA)
   05212 Pancreatic cancer
    109557823 (PIK3CA)
   05225 Hepatocellular carcinoma
    109557823 (PIK3CA)
   05226 Gastric cancer
    109557823 (PIK3CA)
   05214 Glioma
    109557823 (PIK3CA)
   05221 Acute myeloid leukemia
    109557823 (PIK3CA)
   05220 Chronic myeloid leukemia
    109557823 (PIK3CA)
   05218 Melanoma
    109557823 (PIK3CA)
   05211 Renal cell carcinoma
    109557823 (PIK3CA)
   05215 Prostate cancer
    109557823 (PIK3CA)
   05213 Endometrial cancer
    109557823 (PIK3CA)
   05224 Breast cancer
    109557823 (PIK3CA)
   05222 Small cell lung cancer
    109557823 (PIK3CA)
   05223 Non-small cell lung cancer
    109557823 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109557823 (PIK3CA)
   05017 Spinocerebellar ataxia
    109557823 (PIK3CA)
   05020 Prion disease
    109557823 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109557823 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109557823 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    109557823 (PIK3CA)
   04931 Insulin resistance
    109557823 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109557823 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109557823 (PIK3CA)
   05135 Yersinia infection
    109557823 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    109557823 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109557823 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    109557823 (PIK3CA)
   05162 Measles
    109557823 (PIK3CA)
   05164 Influenza A
    109557823 (PIK3CA)
   05161 Hepatitis B
    109557823 (PIK3CA)
   05160 Hepatitis C
    109557823 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    109557823 (PIK3CA)
   05163 Human cytomegalovirus infection
    109557823 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109557823 (PIK3CA)
   05169 Epstein-Barr virus infection
    109557823 (PIK3CA)
   05165 Human papillomavirus infection
    109557823 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109557823 (PIK3CA)
   05142 Chagas disease
    109557823 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109557823 (PIK3CA)
   01524 Platinum drug resistance
    109557823 (PIK3CA)
   01522 Endocrine resistance
    109557823 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109557823 (PIK3CA)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     109557823 (PIK3CA)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109557823 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 109557823
NCBI-ProteinID: XP_019814941
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acgttaataacgataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtttatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaaacagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctattctcaactgccaatggac
tgttttacaatgccatcatattccagacgcatctccacagctacgccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatttatgttcgaacaggtatc
taccayggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgtgaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaactctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaagcctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcggtgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtactaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcgttaactaat
caaaggatcggtcactttttcttttggcatttaaaatctgagatgcataataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatctgaag
caccttaataggcaagttgaggctatggaaaagctcattaacttgactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctccagggctttctgtctcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcttctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacccttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggatgtctgtca
atcggtgactgtgtgggacttatcgaggtggtgagaaattctcacactataatgcagatt
cagtgtaaaggaggcctgaaaggtgcactgcagtttaacagccacacactccatcagtgg
ctcaaagacaagaacaagggggaaatatatgatgcggccatcgatttgtttacacgatca
tgtgctggatattgtgttgccaccttcattttgggaattggagatcgtcacaatagtaat
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgcgtgccgtttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactgcaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggagtatttcatg
aaacaaatgaatgatgcacaccatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Bos indicus (zebu cattle): 109559805
Entry
109559805         CDS       T04792                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00562  Inositol phosphate metabolism
biu01100  Metabolic pathways
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05100  Bacterial invasion of epithelial cells
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05142  Chagas disease
biu05146  Amoebiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109559805 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109559805 (PIK3CB)
   04014 Ras signaling pathway
    109559805 (PIK3CB)
   04015 Rap1 signaling pathway
    109559805 (PIK3CB)
   04370 VEGF signaling pathway
    109559805 (PIK3CB)
   04630 JAK-STAT signaling pathway
    109559805 (PIK3CB)
   04668 TNF signaling pathway
    109559805 (PIK3CB)
   04066 HIF-1 signaling pathway
    109559805 (PIK3CB)
   04068 FoxO signaling pathway
    109559805 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    109559805 (PIK3CB)
   04072 Phospholipase D signaling pathway
    109559805 (PIK3CB)
   04071 Sphingolipid signaling pathway
    109559805 (PIK3CB)
   04024 cAMP signaling pathway
    109559805 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    109559805 (PIK3CB)
   04152 AMPK signaling pathway
    109559805 (PIK3CB)
   04150 mTOR signaling pathway
    109559805 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109559805 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    109559805 (PIK3CB)
   04218 Cellular senescence
    109559805 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109559805 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    109559805 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109559805 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109559805 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    109559805 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    109559805 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    109559805 (PIK3CB)
   04660 T cell receptor signaling pathway
    109559805 (PIK3CB)
   04662 B cell receptor signaling pathway
    109559805 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    109559805 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    109559805 (PIK3CB)
   04670 Leukocyte transendothelial migration
    109559805 (PIK3CB)
   04062 Chemokine signaling pathway
    109559805 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109559805 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    109559805 (PIK3CB)
   04929 GnRH secretion
    109559805 (PIK3CB)
   04915 Estrogen signaling pathway
    109559805 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    109559805 (PIK3CB)
   04917 Prolactin signaling pathway
    109559805 (PIK3CB)
   04926 Relaxin signaling pathway
    109559805 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    109559805 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    109559805 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109559805 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109559805 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    109559805 (PIK3CB)
   04722 Neurotrophin signaling pathway
    109559805 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109559805 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    109559805 (PIK3CB)
   04380 Osteoclast differentiation
    109559805 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    109559805 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    109559805 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559805 (PIK3CB)
   05206 MicroRNAs in cancer
    109559805 (PIK3CB)
   05205 Proteoglycans in cancer
    109559805 (PIK3CB)
   05203 Viral carcinogenesis
    109559805 (PIK3CB)
   05230 Central carbon metabolism in cancer
    109559805 (PIK3CB)
   05231 Choline metabolism in cancer
    109559805 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109559805 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109559805 (PIK3CB)
   05212 Pancreatic cancer
    109559805 (PIK3CB)
   05225 Hepatocellular carcinoma
    109559805 (PIK3CB)
   05226 Gastric cancer
    109559805 (PIK3CB)
   05214 Glioma
    109559805 (PIK3CB)
   05221 Acute myeloid leukemia
    109559805 (PIK3CB)
   05220 Chronic myeloid leukemia
    109559805 (PIK3CB)
   05218 Melanoma
    109559805 (PIK3CB)
   05211 Renal cell carcinoma
    109559805 (PIK3CB)
   05215 Prostate cancer
    109559805 (PIK3CB)
   05213 Endometrial cancer
    109559805 (PIK3CB)
   05224 Breast cancer
    109559805 (PIK3CB)
   05222 Small cell lung cancer
    109559805 (PIK3CB)
   05223 Non-small cell lung cancer
    109559805 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559805 (PIK3CB)
   05017 Spinocerebellar ataxia
    109559805 (PIK3CB)
   05020 Prion disease
    109559805 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109559805 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109559805 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    109559805 (PIK3CB)
   04931 Insulin resistance
    109559805 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109559805 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109559805 (PIK3CB)
   05135 Yersinia infection
    109559805 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    109559805 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559805 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    109559805 (PIK3CB)
   05162 Measles
    109559805 (PIK3CB)
   05164 Influenza A
    109559805 (PIK3CB)
   05161 Hepatitis B
    109559805 (PIK3CB)
   05160 Hepatitis C
    109559805 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    109559805 (PIK3CB)
   05163 Human cytomegalovirus infection
    109559805 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559805 (PIK3CB)
   05169 Epstein-Barr virus infection
    109559805 (PIK3CB)
   05165 Human papillomavirus infection
    109559805 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109559805 (PIK3CB)
   05142 Chagas disease
    109559805 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109559805 (PIK3CB)
   01524 Platinum drug resistance
    109559805 (PIK3CB)
   01522 Endocrine resistance
    109559805 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109559805 (PIK3CB)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     109559805 (PIK3CB)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109559805 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 109559805
NCBI-ProteinID: XP_019817349
Position
1
AA seq 1070 aa
MCFYFMMPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISCIKQMLW
KQVTNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKHTYPPEL
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHSLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMVAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEPLEFDINTCDLPRMTRLCFAVYAVLDKVKTKKSTKTM
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPHALPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKTEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttctacttcatgatgcctcctgctatggcagacgtccttgacatctgggcagtg
gactcacagatagcgtctgatggctccatacccgtggattttcttttgcccactgggatt
tatatccagttggaggtgcctcgtgaagctaccatttcctgtattaagcagatgttatgg
aaacaagttaccaattacccaatgtttaacctccttatggaaatcgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggaactcgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcagattcagtgaggaaaagatt
cagtcgcttgtgggattatcttggatggattggctaaagcatacctatccacctgagctt
gaaccatccatccctgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaggtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtctgactattcatgggaaagaagatgaa
gttagcccttatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cactcactaattcagttccagtatatccggaactgtgtaatgaacagaacattgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtatgaacaggagatggttgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaatcctttccaaattgtcttggttaaagga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggccggcctttttcatggt
accgaactcctgtgtaaaactgtcgtaagctcagagatatcagggaagaatgatcatatt
tggaatgaaccactggaatttgatatcaacacttgtgacctgccacgaatgactcgatta
tgttttgctgtttatgcagttttggataaagtgaaaactaagaaatcaactaaaaccatg
aatccctctaagtatcagaccatcaggaaatctggaaaagtgcattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagatataatattacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatacagaaaatgcaacagctttgcacataaaattcccagagaataaaaaa
caaccttattactatcctcccttcgataagattattgaaaaagcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatcctttgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacacgcgttgccgaaattgctgctgtcgatc
aagtggaataaacttgaggatgttgctcagcttcaagcactgcttcagatttggcctaaa
ctgcccccccgggaggcccttgagcttctagatttcaactatccagatcagtatgtgcga
gaatatgctgtgggctgcctgcaacagatgagtgatgaagaactctctcaatatctttta
cagttggtgcaagttttaaaatatgagccttttcttgattgtgccttgtctagattccta
ctagaaagagcacttgctaatcggaggatagggcagtttttattttggcacctcagatct
gaagtacacattcctgctgtttcagtacaatttggtgttatccttgaagcgtactgccgg
ggaagcgtaggtcacatgaaggcgctttctaagcaggttgaagcactcaataaactaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaatagagccaaagggaaagaa
gcaatgcacacttgtttaaaacagaatgcttaccgtgaagccctctctgacctgcagtca
cctctcaacccatgtgttatcctctcagaactctatgttgagaagtgtaaatacatggat
tccaaaatgaagcctttgtggcttgtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggaccttcggatgctaccttacggc
tgcttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgttgctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctatcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataayatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acttatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgccggcatgggaatctcttc
atcacgctctttgcactgatgttgactgcagggcttcctgagctcacctcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagactgaagaagaagcactcaagcaa
ttcaagcaaaaatttgatgaggcactcagggaaagttggactactaaagtcaattggatg
gcccacacagttcgcaaagactacagatcttaa

KEGG   Bos indicus (zebu cattle): 109561418
Entry
109561418         CDS       T04792                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05142  Chagas disease
biu05146  Amoebiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109561418 (PIK3R2)
   04014 Ras signaling pathway
    109561418 (PIK3R2)
   04015 Rap1 signaling pathway
    109561418 (PIK3R2)
   04370 VEGF signaling pathway
    109561418 (PIK3R2)
   04630 JAK-STAT signaling pathway
    109561418 (PIK3R2)
   04668 TNF signaling pathway
    109561418 (PIK3R2)
   04066 HIF-1 signaling pathway
    109561418 (PIK3R2)
   04068 FoxO signaling pathway
    109561418 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    109561418 (PIK3R2)
   04072 Phospholipase D signaling pathway
    109561418 (PIK3R2)
   04071 Sphingolipid signaling pathway
    109561418 (PIK3R2)
   04024 cAMP signaling pathway
    109561418 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    109561418 (PIK3R2)
   04152 AMPK signaling pathway
    109561418 (PIK3R2)
   04150 mTOR signaling pathway
    109561418 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109561418 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    109561418 (PIK3R2)
   04218 Cellular senescence
    109561418 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109561418 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    109561418 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109561418 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109561418 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    109561418 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    109561418 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    109561418 (PIK3R2)
   04660 T cell receptor signaling pathway
    109561418 (PIK3R2)
   04662 B cell receptor signaling pathway
    109561418 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    109561418 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    109561418 (PIK3R2)
   04670 Leukocyte transendothelial migration
    109561418 (PIK3R2)
   04062 Chemokine signaling pathway
    109561418 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109561418 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    109561418 (PIK3R2)
   04929 GnRH secretion
    109561418 (PIK3R2)
   04915 Estrogen signaling pathway
    109561418 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    109561418 (PIK3R2)
   04917 Prolactin signaling pathway
    109561418 (PIK3R2)
   04926 Relaxin signaling pathway
    109561418 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    109561418 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    109561418 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109561418 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109561418 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    109561418 (PIK3R2)
   04722 Neurotrophin signaling pathway
    109561418 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109561418 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    109561418 (PIK3R2)
   04380 Osteoclast differentiation
    109561418 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    109561418 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    109561418 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109561418 (PIK3R2)
   05206 MicroRNAs in cancer
    109561418 (PIK3R2)
   05205 Proteoglycans in cancer
    109561418 (PIK3R2)
   05203 Viral carcinogenesis
    109561418 (PIK3R2)
   05230 Central carbon metabolism in cancer
    109561418 (PIK3R2)
   05231 Choline metabolism in cancer
    109561418 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109561418 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109561418 (PIK3R2)
   05212 Pancreatic cancer
    109561418 (PIK3R2)
   05225 Hepatocellular carcinoma
    109561418 (PIK3R2)
   05226 Gastric cancer
    109561418 (PIK3R2)
   05214 Glioma
    109561418 (PIK3R2)
   05221 Acute myeloid leukemia
    109561418 (PIK3R2)
   05220 Chronic myeloid leukemia
    109561418 (PIK3R2)
   05218 Melanoma
    109561418 (PIK3R2)
   05211 Renal cell carcinoma
    109561418 (PIK3R2)
   05215 Prostate cancer
    109561418 (PIK3R2)
   05213 Endometrial cancer
    109561418 (PIK3R2)
   05224 Breast cancer
    109561418 (PIK3R2)
   05222 Small cell lung cancer
    109561418 (PIK3R2)
   05223 Non-small cell lung cancer
    109561418 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109561418 (PIK3R2)
   05017 Spinocerebellar ataxia
    109561418 (PIK3R2)
   05020 Prion disease
    109561418 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109561418 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109561418 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    109561418 (PIK3R2)
   04931 Insulin resistance
    109561418 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109561418 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109561418 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    109561418 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109561418 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    109561418 (PIK3R2)
   05162 Measles
    109561418 (PIK3R2)
   05164 Influenza A
    109561418 (PIK3R2)
   05161 Hepatitis B
    109561418 (PIK3R2)
   05160 Hepatitis C
    109561418 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    109561418 (PIK3R2)
   05163 Human cytomegalovirus infection
    109561418 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109561418 (PIK3R2)
   05169 Epstein-Barr virus infection
    109561418 (PIK3R2)
   05165 Human papillomavirus infection
    109561418 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109561418 (PIK3R2)
   05142 Chagas disease
    109561418 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109561418 (PIK3R2)
   01524 Platinum drug resistance
    109561418 (PIK3R2)
   01522 Endocrine resistance
    109561418 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109561418 (PIK3R2)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109561418 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e Tai4 ATG11 Laminin_I
Other DBs
NCBI-GeneID: 109561418
NCBI-ProteinID: XP_019819413
Position
7
AA seq 724 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRXXGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSYRPEPPAVRTDWSLSDVEQWDAAALSDGVKGFLLALPA
PLVTPEAAAEAHRALREAAGPVGPALEPPTLPLHHALTLRFLLQHLGRVAGRAPAPGPAV
RALGATFGPLLLRAPPPPSPPPGGAPDGTEPTPDFPALLVEKLLQEHLEEQEVAPPALPP
KPPKTKPAPTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGE
YTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYP
VSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAF
NETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQ
ELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQ
YSLMEXEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGD
TKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPP
PAAR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggctggccctgagggcttccaataccgtgcattgtacccattccgccgggagcggccg
gaggacctggagctgcttccgggtgatgtgctggtggtgagcagggccgccctgcaggcg
ctgggcgtggccgagggcaacgagcgctgcccgcagagcgtaggctggatgcctggcctc
aatgagcgtacccggcagcgcggcgacttccctggcacctatgtggagttcctggggccc
gtggccctggcccggcctggccctcgccnnnnnggcccccgcccactgcccgccaggccc
cgagacgggccccctgagccaggccttacactccctgacctacccgagcagttctccccc
cctgatgtggctccccctatcctggtgaagctggtggaggccattgaacggacagggctg
gacagctacaggcctgagccacccgccgtgcgcacagactggtccctgagtgatgtggag
cagtgggatgcggcagccctgtcagatggtgtgaaaggcttcctgctggcgctgccagcg
cccctcgtgacacccgaggctgcggccgaggcacaccgagccctgcgggaggctgcgggg
cccgtggggccggcgttggagcccccgacgctgccactgcaccatgcgctcacgctgcgc
ttcctgctccagcacctgggccgggtggccgggcgcgccccagccccrggccccgcggtc
cgtgccctgggcgccaccttcgggccgctgctgctacgcgcgccgccgccgccctctccg
ccgccagggggcgcacccgacgggaccgagcccacccccgactttcctgcgctgctggtg
gagaagctgcttcaggaacatctggaggagcaggaggttgcccccccagcactgccacca
aaaccccccaagacaaagccagcccccacaggcctggccaatgggggcagcccaccctcc
ctgcaggacgccgagtggtactggggtgacatctccagggaggaggtaaacgagaaactg
cgggacacgcccgatggcaccttcctggtccgagatgcctccagcaagatccagggagag
tacacgctgaccctcaggaaaggcggaaacaacaagctgatcaaggtcttccaccgagat
gggcactacggcttctcggagccgctcaccttctgctctgtcgtggacctcatcacccac
taccgccatgagtcactggcccagtacaacgccaagctggacacgcggctcctctaccca
gtgtccaagtaccaacaggaccagatcgtcaaggaggacagcgtggaggcggtgggtgcc
cagctcaaggtctaccaccagcagtaccaggacaagagccgcgagtacgaccagctctac
gaggagtacacacgcacctcccaggaactgcagatgaagcgcacagccatcgaagccttc
aatgagaccatcaagatctttgaagagcagggccagacgcaggagaagtgcagcaaggaa
tacctggagcgcttccgacgtgagggcaatgagaaagaaatgcagaggatcctgctaaac
tcggagcggctcaagtctcgcattgccgagatccacgagagtcgcacaaagctggagcag
gagctgcgggcacaggcctctgacaaccgagagatcgacaagcgcatgaacagcctcaag
ccagacctcatgcagttgcgcaagatccgagaccagtaccttgtgtggctcactcagaag
ggtgcccggcagaagaaaatcaacgaatggttggggatcaagaacgagactgaggaccag
tactcactgatggagsatgaggatgacctcccccaccacgaggaacgcacctggtatgta
ggcaagatcaaccgcacccaagctgaggaaatgctgagtggcaagcgggacggtaccttc
ctcatccgtgagagcagccagcggggttgctacgcctgttctgtggtggtggacggggat
accaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcggagccctacaac
ctgtacgggtccctgaaggagctcgtcctccactaccagcacgcctcgctggtgcagcac
aacgacgcgctgaccgtcacgctcgcccaccccgtgcgcgcccccggccctgggcccccg
ccggctgcgcgctga

KEGG   Bos indicus (zebu cattle): 109570415
Entry
109570415         CDS       T04792                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00562  Inositol phosphate metabolism
biu01100  Metabolic pathways
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05100  Bacterial invasion of epithelial cells
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05142  Chagas disease
biu05146  Amoebiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109570415 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109570415 (PIK3CD)
   04014 Ras signaling pathway
    109570415 (PIK3CD)
   04015 Rap1 signaling pathway
    109570415 (PIK3CD)
   04370 VEGF signaling pathway
    109570415 (PIK3CD)
   04630 JAK-STAT signaling pathway
    109570415 (PIK3CD)
   04668 TNF signaling pathway
    109570415 (PIK3CD)
   04066 HIF-1 signaling pathway
    109570415 (PIK3CD)
   04068 FoxO signaling pathway
    109570415 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    109570415 (PIK3CD)
   04072 Phospholipase D signaling pathway
    109570415 (PIK3CD)
   04071 Sphingolipid signaling pathway
    109570415 (PIK3CD)
   04024 cAMP signaling pathway
    109570415 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    109570415 (PIK3CD)
   04152 AMPK signaling pathway
    109570415 (PIK3CD)
   04150 mTOR signaling pathway
    109570415 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109570415 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    109570415 (PIK3CD)
   04218 Cellular senescence
    109570415 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109570415 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    109570415 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109570415 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109570415 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    109570415 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    109570415 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    109570415 (PIK3CD)
   04660 T cell receptor signaling pathway
    109570415 (PIK3CD)
   04662 B cell receptor signaling pathway
    109570415 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    109570415 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    109570415 (PIK3CD)
   04670 Leukocyte transendothelial migration
    109570415 (PIK3CD)
   04062 Chemokine signaling pathway
    109570415 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109570415 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    109570415 (PIK3CD)
   04929 GnRH secretion
    109570415 (PIK3CD)
   04915 Estrogen signaling pathway
    109570415 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    109570415 (PIK3CD)
   04917 Prolactin signaling pathway
    109570415 (PIK3CD)
   04926 Relaxin signaling pathway
    109570415 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    109570415 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    109570415 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109570415 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109570415 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    109570415 (PIK3CD)
   04722 Neurotrophin signaling pathway
    109570415 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109570415 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    109570415 (PIK3CD)
   04380 Osteoclast differentiation
    109570415 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    109570415 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    109570415 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570415 (PIK3CD)
   05206 MicroRNAs in cancer
    109570415 (PIK3CD)
   05205 Proteoglycans in cancer
    109570415 (PIK3CD)
   05203 Viral carcinogenesis
    109570415 (PIK3CD)
   05230 Central carbon metabolism in cancer
    109570415 (PIK3CD)
   05231 Choline metabolism in cancer
    109570415 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109570415 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109570415 (PIK3CD)
   05212 Pancreatic cancer
    109570415 (PIK3CD)
   05225 Hepatocellular carcinoma
    109570415 (PIK3CD)
   05226 Gastric cancer
    109570415 (PIK3CD)
   05214 Glioma
    109570415 (PIK3CD)
   05221 Acute myeloid leukemia
    109570415 (PIK3CD)
   05220 Chronic myeloid leukemia
    109570415 (PIK3CD)
   05218 Melanoma
    109570415 (PIK3CD)
   05211 Renal cell carcinoma
    109570415 (PIK3CD)
   05215 Prostate cancer
    109570415 (PIK3CD)
   05213 Endometrial cancer
    109570415 (PIK3CD)
   05224 Breast cancer
    109570415 (PIK3CD)
   05222 Small cell lung cancer
    109570415 (PIK3CD)
   05223 Non-small cell lung cancer
    109570415 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109570415 (PIK3CD)
   05017 Spinocerebellar ataxia
    109570415 (PIK3CD)
   05020 Prion disease
    109570415 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109570415 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109570415 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    109570415 (PIK3CD)
   04931 Insulin resistance
    109570415 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109570415 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109570415 (PIK3CD)
   05135 Yersinia infection
    109570415 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    109570415 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109570415 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    109570415 (PIK3CD)
   05162 Measles
    109570415 (PIK3CD)
   05164 Influenza A
    109570415 (PIK3CD)
   05161 Hepatitis B
    109570415 (PIK3CD)
   05160 Hepatitis C
    109570415 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    109570415 (PIK3CD)
   05163 Human cytomegalovirus infection
    109570415 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570415 (PIK3CD)
   05169 Epstein-Barr virus infection
    109570415 (PIK3CD)
   05165 Human papillomavirus infection
    109570415 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109570415 (PIK3CD)
   05142 Chagas disease
    109570415 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109570415 (PIK3CD)
   01524 Platinum drug resistance
    109570415 (PIK3CD)
   01522 Endocrine resistance
    109570415 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109570415 (PIK3CD)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     109570415 (PIK3CD)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109570415 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DOCK-C2 DUF4135
Other DBs
NCBI-GeneID: 109570415
NCBI-ProteinID: XP_019831910
Position
16
AA seq 1044 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKPLILTLTWLP
RLSGLHEFDSLQDPEVNDFRGKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRVLLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFYIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGEHCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAP
HPVYYPFLDKILELGRLGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLSSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRRIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVVKVSSQKTTKPQTKELMHLCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGTVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLXLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
gcagttgatttcttgctccccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcactatcaagaaggtgttatggcaccgagcccagtacgagccgctcttccac
atgctcagtgaccctgaggcctacgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgcccgtcctgcgg
ctggtggcccgcgagggtgaccgcgtgaagcccctgatcctgacgctgacctggctccct
cgcctctcaggcctccacgagtttgactccttgcaagacccggaggtgaatgacttccga
ggcaagatgcgccagttctgcgaggaggcggctgcccgcaggcagcagctgggctgggag
gcctggctgcagtacagcttccctctgcagttggagccctcggcgcggagctgggggcca
ggcaccctgcgcgtccccaatcgggtcctcctggtcaatgtcaagtttgagggcagcgag
gagagcttcaccttccaggtatccaccaaggatgtgcccctggcactgatggcctgtgcc
ctccgaaagaaggccacggtgttccggcagccgctggtggagcagcctgaggactacacg
ctgcaggtgaacggcaagcacgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagtgggctgaccccgcacctgaccatggtgcactcctcc
tccattctcgccatgcgggacgagcagagcaaccctgccccccaagtccagaagccacgc
accaaaccaccccccatccccatgaagaagccctcctctgtgtccctctggtccctggag
cagcctttctacatcgagctgatccagggcagcaaagtgaatgccgacgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaatgagacgctatgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggagcccgtgtggaagcagcggctggagtttgacatcaac
atctgtgacctgccccgcatggcccggctctgcttcgcgctttacgctgtgatcgagaag
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagacgggcgagcactgtctctat
atgtggccctctgtcccagacgagaaaggggaactactgaacccctgtgggaccgtgcgg
agtaaccccaacactgagagtgcagccgccctggtcatctttctccctgaggtggcccct
caccctgtatactaccctttcctggacaagatcctggagctggggcggcttggagagcat
ggacgcttcacggaggaggagcagctgcagctgcgggagatcctggagcggcggggttcc
ggggaactgtacgagcacgagaaggacctagtgtggaagatgcggcacgagatccaggag
cactttcccgaggctctagcccggctgctgctggtcactaagtggaacaaacatgaggac
gtggcccagatgctctacctgctcagctcctggcctgaactgcccgttctgagcgccctg
gagttgctagacttcagcttccccgaccgccacgtgggatccttcgccatcaagtccctg
cggaaactaacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggccaat
cgcaggatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggccttatcatggaagcctattgccggggcagcacccaccacatgaaa
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaacgacgtcgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacttgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaaacccctgtgg
gtcatgtacagcaacgaggaggcaggcagcgacggcaccgtgggcatcatctttaagaat
ggggacgacctccgccaggacatgctgaccctgcagatgatccagctcatggacattctg
tggaagcaggagggcttggacctgaggatgaccccctacggctgcctctccactggggac
cgcacaggccttatcgaggtggtgcttcactcagacaccattgccaacatccagctgaac
aagagcaacatggcggccacggctgccttcaataaggatgctctgctcaactggctcaag
tccaagaaccctggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggctacctatgtgctgggcattggcgatcgtcacagcgacaacatcatg
atccgagagaacgggcagctgttccacattgatttcggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgggtcccgttcatcctcacctatgactttgtccac
gtgatccagcaagggaagacgaataatagtgagaagtttgaaaggttccggggctactgt
gagagggcctacaccatcctgcggcgccatgggctcctttkcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggat
tctctggcattggggaaaacggaggaggaggctctgaagcacttccgagtgaagtttaat
gaagccctccgggaaagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaataa

KEGG   Bos indicus (zebu cattle): 109574805
Entry
109574805         CDS       T04792                                 

Gene name
PIK3R1
Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01522  Endocrine resistance
biu01524  Platinum drug resistance
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04066  HIF-1 signaling pathway
biu04068  FoxO signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04071  Sphingolipid signaling pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04611  Platelet activation
biu04620  Toll-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04668  TNF signaling pathway
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04750  Inflammatory mediator regulation of TRP channels
biu04810  Regulation of actin cytoskeleton
biu04910  Insulin signaling pathway
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04917  Prolactin signaling pathway
biu04919  Thyroid hormone signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04926  Relaxin signaling pathway
biu04929  GnRH secretion
biu04930  Type II diabetes mellitus
biu04931  Insulin resistance
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04935  Growth hormone synthesis, secretion and action
biu04960  Aldosterone-regulated sodium reabsorption
biu04973  Carbohydrate digestion and absorption
biu05010  Alzheimer disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05142  Chagas disease
biu05146  Amoebiasis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
biu05231  Choline metabolism in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109574805 (PIK3R1)
   04014 Ras signaling pathway
    109574805 (PIK3R1)
   04015 Rap1 signaling pathway
    109574805 (PIK3R1)
   04370 VEGF signaling pathway
    109574805 (PIK3R1)
   04630 JAK-STAT signaling pathway
    109574805 (PIK3R1)
   04668 TNF signaling pathway
    109574805 (PIK3R1)
   04066 HIF-1 signaling pathway
    109574805 (PIK3R1)
   04068 FoxO signaling pathway
    109574805 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    109574805 (PIK3R1)
   04072 Phospholipase D signaling pathway
    109574805 (PIK3R1)
   04071 Sphingolipid signaling pathway
    109574805 (PIK3R1)
   04024 cAMP signaling pathway
    109574805 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    109574805 (PIK3R1)
   04152 AMPK signaling pathway
    109574805 (PIK3R1)
   04150 mTOR signaling pathway
    109574805 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109574805 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    109574805 (PIK3R1)
   04218 Cellular senescence
    109574805 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109574805 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    109574805 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109574805 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109574805 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    109574805 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    109574805 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    109574805 (PIK3R1)
   04660 T cell receptor signaling pathway
    109574805 (PIK3R1)
   04662 B cell receptor signaling pathway
    109574805 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    109574805 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    109574805 (PIK3R1)
   04670 Leukocyte transendothelial migration
    109574805 (PIK3R1)
   04062 Chemokine signaling pathway
    109574805 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109574805 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    109574805 (PIK3R1)
   04929 GnRH secretion
    109574805 (PIK3R1)
   04915 Estrogen signaling pathway
    109574805 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    109574805 (PIK3R1)
   04917 Prolactin signaling pathway
    109574805 (PIK3R1)
   04926 Relaxin signaling pathway
    109574805 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    109574805 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    109574805 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109574805 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109574805 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    109574805 (PIK3R1)
   04722 Neurotrophin signaling pathway
    109574805 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109574805 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    109574805 (PIK3R1)
   04380 Osteoclast differentiation
    109574805 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    109574805 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    109574805 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574805 (PIK3R1)
   05206 MicroRNAs in cancer
    109574805 (PIK3R1)
   05205 Proteoglycans in cancer
    109574805 (PIK3R1)
   05203 Viral carcinogenesis
    109574805 (PIK3R1)
   05230 Central carbon metabolism in cancer
    109574805 (PIK3R1)
   05231 Choline metabolism in cancer
    109574805 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109574805 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109574805 (PIK3R1)
   05212 Pancreatic cancer
    109574805 (PIK3R1)
   05225 Hepatocellular carcinoma
    109574805 (PIK3R1)
   05226 Gastric cancer
    109574805 (PIK3R1)
   05214 Glioma
    109574805 (PIK3R1)
   05221 Acute myeloid leukemia
    109574805 (PIK3R1)
   05220 Chronic myeloid leukemia
    109574805 (PIK3R1)
   05218 Melanoma
    109574805 (PIK3R1)
   05211 Renal cell carcinoma
    109574805 (PIK3R1)
   05215 Prostate cancer
    109574805 (PIK3R1)
   05213 Endometrial cancer
    109574805 (PIK3R1)
   05224 Breast cancer
    109574805 (PIK3R1)
   05222 Small cell lung cancer
    109574805 (PIK3R1)
   05223 Non-small cell lung cancer
    109574805 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109574805 (PIK3R1)
   05017 Spinocerebellar ataxia
    109574805 (PIK3R1)
   05020 Prion disease
    109574805 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109574805 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109574805 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    109574805 (PIK3R1)
   04931 Insulin resistance
    109574805 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109574805 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109574805 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    109574805 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109574805 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    109574805 (PIK3R1)
   05162 Measles
    109574805 (PIK3R1)
   05164 Influenza A
    109574805 (PIK3R1)
   05161 Hepatitis B
    109574805 (PIK3R1)
   05160 Hepatitis C
    109574805 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    109574805 (PIK3R1)
   05163 Human cytomegalovirus infection
    109574805 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109574805 (PIK3R1)
   05169 Epstein-Barr virus infection
    109574805 (PIK3R1)
   05165 Human papillomavirus infection
    109574805 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109574805 (PIK3R1)
   05142 Chagas disease
    109574805 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109574805 (PIK3R1)
   01524 Platinum drug resistance
    109574805 (PIK3R1)
   01522 Endocrine resistance
    109574805 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109574805 (PIK3R1)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    109574805 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I
Other DBs
NCBI-GeneID: 109574805
NCBI-ProteinID: XP_019838323
Position
20
AA seq 723 aa
MSAEGYQYRALYDYKKERXEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFRELTXNIWXEKISPPTPKPRPPRPLPVAPGPSKTEADSEQQASTLPDLAEQ
FAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDTASLDLEMFDVHV
LADAFKRYLLDLPNPVIPVAVSSELISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQ
YLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNER
QPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDAS
TKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLD
VKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKR
TAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDS
RRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNE
NTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSV
VVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQ
QRR
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccagtaccgggcgctgtacgactataagaaggagcgggamgag
gacattgacttgcacctgggggacatattgactgtgaacaaagggtccttrgtcgctctt
ggattcagtgatggacaggaagccaagcctgaagaaattggctggttaaatggctataac
gagacgacaggggagaggggagactttcgggaacttacgtagaatatatggarggaaaag
atctcgcctcccacaccaaagccccggccacctcgaccccttcctgttgccccaggtcct
tcaaaaactgaagcagacagygagcaacaagcttccactctcccagaccttgcagagcag
ttcgcaccccctgacgttgctccaccgcttcttatcaagctcgtggaagccattgaaaag
aaaggtctggaatgttcaactctatacagaacacagagctccagcaacccagccgagtta
cgacagcttcttgattgtgataccgcctccttggacttggagatgttcgatgtgcacgtt
ttagctgacgccttcaaacgctatctcctggacttaccgaatcctgtcattccggtagcc
gtttccagtgaactgatttctttagccccagaagtgcagagttctgaagaatacatccag
ctgttgaagaaactcattaggtcgcccagcatacctcatcagtactggctcacactgcag
tatttgctaaaacatttcttcaagctctctcaaacgtccagcaaaaatcttctgaatgca
agagtactttctgaactcttcagccctctgcttttcagattcccagcagcaagttctgag
aatactgaacacctcataaaaattatagaaatcttaatctccaccgaatggaatgaacgc
cagcctgcaccagcactgcctcccaaaccaccaaaacccactactgtagccaacaacggt
atgaataacaatatgtctttacaagatgctgaatggtactggggagatatctcgagggaa
gaagtgaatgaaaaacttcgagacacagctgacgggacctttttggtacgagacgcatct
actaaaatgcatggggattacacgcttacactaaggaaaggaggaaataacaaattaatc
aaratatttcaccgagatgggaaatatggcttytctgacccattaaccttcaactctgtg
gttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaaactggat
gtgaaattactttatccagtatccaaataccaacaggatcaagttgtcaaagaagataat
attgaagctgtagggaaaaaattacatgaatataacactcaatttcaagaaaaaagtcgg
gaatatgatagattatatgaagactatacccgaacttcccaggaaatccaaatgaaaaga
acagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaaacccag
gagcggtacagcaaagaatacatagaaaagttcaaacgtgaaggcaacgagacggaaatc
caaaggattatgcataattatgaaaagttaaagtctcgaatcagtgaaattgtcgacagc
agaaggagattggaagaggacttgaagaagcaggcggctgagtatcgtgagattgacaaa
cgcatgaacagcattaaaccagacctcattcagctaagaaagacgagagaccaatacttg
atgtggttgactcagaaaggtgttcggcagaagaaattgaacgagtggctgggcaatgaa
aacactgaagaccaatattcgctggtagaagatgatgaggatttgccccaccacgatgag
aagacttggaatgttggaagcagcaaccgaaacaaagctgaaaacctgttgcgagggaag
cgagacggcacttttcttgtccgggaaagcagtaaacagggctgctacgcctgctctgtg
gtggtggacggcgaggtcaagcactgcgtcatcaacaagacggccacgggctacggcttc
gccgagccctacaacctgtacagctccctcaaggagctggtgctccactaccagcacacc
tctctcgtgcagcacaacgactccctcaacgtcacactagcctacccggtgtacgcgcag
cagaggcgatga

DBGET integrated database retrieval system