KEGG   Bos indicus (zebu cattle): 109556400
Entry
109556400         CDS       T04792                                 

Gene name
PTPRF
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase F isoform X1
  KO
K05695  receptor-type tyrosine-protein phosphatase F [EC:3.1.3.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04520  Adherens junction
biu04910  Insulin signaling pathway
biu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556400 (PTPRF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109556400 (PTPRF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109556400 (PTPRF)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109556400 (PTPRF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109556400 (PTPRF)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     109556400 (PTPRF)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    109556400 (PTPRF)
SSDB
Motif
Pfam: Y_phosphatase fn3 I-set Ig_3 Pur_ac_phosph_N Ig_2 ig fn3_2 Interfer-bind PTP_tm DSPc Y_phosphatase3 C2-set_2 PTPlike_phytase Ig_5 Insulin_TMD ICAM_N
Other DBs
NCBI-GeneID: 109556400
NCBI-ProteinID: XP_019813216
Position
3
AA seq 1918 aa
MTPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFVKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPLGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPAAS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVSYYGIQYRPAGAE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRXPPSEAVRXRTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVDSDTRIQLSWLLPPQERI
VKYELVYWAAEDEGQQHKVTFDPTSSYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEAR
TAQSTPSAPPQKVTCVSVGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GIGREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVRVSWKLPVPSKQHGQIRGYQVTYVRLXNGEPRGAPIIQDVMLAEAQWQPEESEDY
ETTISGLTPETTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMVSTTAMNTALLQW
HPPKELPGELLGYRLQYRRADEARPSTIDFGKDDQHFTVTGLHKGATYIFRLTAKNRAGL
GEEFEKEITTPEDVPSGFPQNLRVIGLTTSTTELIWDPPVLAERNGRITNYTVVYRDINS
QQELQNVTADTHLTLSGLKPDTTYDIKVRARTSKGAGPLSPSIQSRTMPVEQVFAKNFRV
EAAMKTSVLLSWEVPDSYKSAVPFRILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNR
GSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFTLTMPRVQEPALVRWFYIMVVPID
RMGGSMLAPQWSTPEELELDELLEAIEQGGGERLRRRRQTERLKPYVAAQVDVLPETFTL
GDKKNYQGFYNRPLSPDLSYQCFVLASLKEPVDQKRYACSPYSDEIVVQVTPAQQQEEPE
LLWVTGPVLAVILIVLIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLN
YQTPGSSVPSCPNISSMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWEN
SNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPE
TMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYT
VRTFALYKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCS
AGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAAM
CGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLANSKAHTSRFISANLPCNKFKNR
LVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWE
HNSTIIVMLTRLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARD
GQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVF
ITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
NT seq 5757 nt   +upstreamnt  +downstreamnt
atgacccctgagccagccccagggaggacgatggtgccccttgtccctgcacttgtgatg
cttggtttggtggcaggtgcccatggcgacagcaaacctgtgtttgtcaaggtccccgag
gaccagactggattgtcaggaggggtggcctccttcgtgtgccaagccacgggggaaccc
aagccacgcatcacatggatgaagaaggggaagaaagtcagctcccagcgcttcgaggtc
attgagtttgacgacggggcagggtctgtgctgcggatccagccactgcgggtgcagcga
gacgaagccatctatgagtgcacggccaccaatagtctgggggagatcaacaccagtgcc
aagctctcagtrctcgaagaggaacagctgccccttgggttcccctccatcgacatgggg
cctcagctgaaggtggtggagaaggcccgcacggccactatgctgtgtgcagcaggcggg
aatccagaccctgagatctcttggttcaaggacttcctccctgtggaccccgccgcgagc
aacggccgcatcaagcaactgcgttcaggtgccttgcagattgagagcagcgaggagtcg
gaccaaggcaagtacgagtgtgtggcgaccaactctgcaggcactcgttactcggcccct
gccaacctatatgtgcgagtgcgccgcgtggctccgcgtttctccatccctcccagcagc
caggaggtgatgccgggcggcagcgtgaacctgacgtgcgtcgccgttggcgcacccatg
ccctacgtgaagtggatgatgggggccgaagagctcaccaaggaggacgagatgccggtc
ggccgcaatgtgctggarctcagcaacgtggtgcgctcygccaactacacttgcgtggcc
atctcctccctgggcatgatcgaggccacggcccaggtcaccgtgaaagccctgccgaag
cctccaattgaccttgtggtgacagagacaactgccaccagcgtcactctgacctgggac
tctgggaactcagagcctgtatcctactatggcatccagtaccgcccagcgggcgcggag
ggccccttccaggaggtggacggcgtggccaccacccgctacagcatcggcggcctgagc
cctttctcagagtacgccttccgcgtgctggcggtgaacagcatcgggcgcgnnccgccc
agcgaggcggtgcgggygcgcacgggggagcaggcgccctccagccccccgcgccgcgtg
caggcacgcatgctaagcgccagcaccatgctggtgcagtgggagccgcccgaggagcct
aacggcctggtgcggggctaccgcgtctactacacccccgactcccgccgccctctgagc
gcctggcacaagcacaacacagacgccgggctcctcaccactgtgggcagcctgctgcct
ggcatcacctacagcctgcgtgtgctggccttcaccgccgtgggcgacggcccccccagc
cccaccatccaggtcaagacgcagcagggagtgcctgcccagcccgcggacttccaggcc
gaggtggactcagacaccaggatccagctctcgtggctgctgcccccgcaggagcggatc
gtcaagtatgagctggtgtactgggcggcagaggacgagggccagcagcacaaggtgacc
ttcgaccccacgtcctcctataccgtagaggacctgaagcccgacacactgtaccgcttc
cagctggccgcccgctctgagctgggggtgggagtcttcacccccaccattgaggctcgc
acagcacagtccaccccctccgcacccccccagaaggtgacgtgtgtgagcgtgggctcc
accaccgtccgggtaagttgggtcccgccgccggccgacagccgcaacggcgtcatcacc
cagtactcggtggcctacgaggcggtggacggcgaggaccgtgggcggcacgtggtggac
ggcatcggccgcgagcactccagctgggacctggtgggcctggagaagtggacggagtac
cgggtgtgggtgcgggcgcacacggacgtgggccccggccccgagagcagcccggtgctg
gtccgcaccgacgaggacgtgcccagtgggccaccgcggaaggtggaggtggagccgctc
aactccactgccgtgcgcgtctcctggaagctgcccgtccccagcaagcagcatggccag
atccgcggctaccaggtcacctacgtgcggctggrgaatggcgagccccgcggcgccccc
atcatccaggacgtcatgctggccgaggcccagtggcagccagaggagtccgaggactat
gaaaccaccatcagcggcctgaccccggagaccacctactccatcaccgtggctgcctac
accaccaagggggacggtgcccgcagcaagcccaaaattgtcacgaccacgggggcagtc
ccaggacggcccaccatgatggtcagcaccacggccatgaacacggcgctgctccagtgg
cacccgcccaaggagctgcccggggagctcctgggctaccggctgcagtaccgccgagcc
gacgaggcgcggcccagcaccatcgattttggcaaggacgaccagcactttacggtcact
ggcctgcacaaaggggccacctacatcttccggctcactgccaagaaccgggccggcctg
ggcgaggagttcgagaaggaaatcacgacccccgaggacgtgcccagcggtttcccccaa
aacctgcgcgtgatagggctgaccacatctaccacggaactgatctgggaccccccagtg
ctggcggagaggaacgggcgcatcaccaactacaccgtggtgtaccgtgacatcaacagc
cagcaggagcttcagaacgtcactgccgacacccacctgacgctctccggcctcaagcca
gacaccacttacgacatcaaggtccgcgcacgcaccagcaagggcgccggcccgctcagc
cccagcatccagtcccggaccatgcccgtggagcaagtgtttgccaagaacttccgtgtg
gaggctgcaatgaagacatctgtgctgctcagctgggaggtgcccgactcctacaagtca
gcagtgcccttcaggatcctgtacaatgggcagagcgtggaggtggacgggcactccatg
cggaagctgattgcagacctgcagcccaacaccgaatactcatttgtgctgatgaaccgc
ggcagcagcgcggggggcctgcaacacctcgtgtccatccgcacggcccccgacctcctg
ccgcacaagccactgccagcctcggcctacatcgaggacggccgcttcaccctcaccatg
ccccgcgtgcaggaacccgcactggtcaggtggttctacatcatggtggtgcccattgac
cgcatgggagggagcatgctggcgccacagtggagcacgcccgaggagctggagctggac
gagctgctggaggccatcgagcagggcggcggggagcggctgcggcgccggcggcagacg
gagcggctgaagccatacgtggccgctcaggtggacgttctcccggagaccttcaccttg
ggggacaagaagaactatcaaggcttctacaaccggccgctgtctccagacctgagctac
cagtgctttgtgctcgcctccctgaaggaacccgtggaccagaagcgctatgcctgcagc
ccctactccgatgagatcgtggtccaggtgacaccagcccagcagcaggaggaacccgag
ctgctgtgggtgacgggccccgtcctggcagtcattctcatcgtcctcattgtcatcgcc
attctcctgtttaagaggaaaaggacccactccccatcgtccaaggatgagcagtcaatt
gggctgaaggactccttgctggcccactcctccgaccctgtggagatgcggcggctcaac
taccagaccccaggttccagtgtccccagttgcccgaatatctcaagtatgcgagaccac
ccgcccatccccatcaccgacctagctgacaacatcgagcgcctcaaagccaatgacggc
ctcaagttctcccaggagtacgagtcaattgacccaggacagcagttcacgtgggagaat
tcaaacctggaggtgaacaagccgaagaaccgctatgccaacgtcattgcttacgaccac
tctcgagtcatccttacctccatcgatggtgtccccgggagcgactacatcaatgccaat
tacatcgacggttaccgcaagcagaacgcctacattgccacgcagggcccgctgcctgag
accatgggcgatttctggcggatggtgtgggaacagcgcacagccactgtggtcatgatg
acgcggctggaggagaagtcccgggtgaaatgtgaccagtactggccagctcgtggcacc
gagacctatggcctcatccaggtgaccctgctggacacggtggagctggccacctacact
gtgcgcaccttcgcgctctacaagagtggctccagtgagaagcgggagctgcgtcagttc
cagttcatggcctggccagaccacggagtccccgagtacccgacccctatcctggccttc
ctgcggcgggtcaaggcttgcaaccccctggacgcggggcccatggtggtgcactgcagc
gcgggcgtgggccgcacgggctgcttcatcgtcatcgacgccatgctggagcggatgaag
cacgagaagacagtggacatctacggccacgtgacgtgcatgcgggcgcagcgcaactac
atggtgcagactgaggaccagtacgtgttcatccacgaggcgctgctggaggccgccatg
tgtggacacacggaggtgcccgcccgcaacctctacgcccacatccagaagctgggccaa
gtgcctcccggggagagtgtgactgccatggagctggagttcaagttgctggccaactcc
aaggcccacacatcccgcttcatcagcgccaacctgccctgcaacaagttcaagaaccgc
ctggtgaacatcatgccctacgaactgacccgtgtgtgtctgcagcccatccgcggcgtg
gagggctccgactacatcaatgccagcttcctggatggctatcgacagcagaaggcctac
atagccacacaggggcctctggcggagagcaccgaggatttctggcgcatgttatgggag
cacaactccaccatcatcgtcatgctgaccaggcttcgggagatgggccgggagaaatgc
caccagtactggcctgcagagcgctctgctcgctaccagtactttgtcgtcgacccgatg
gctgagtacaacatgccccagtacattctccgtgagttcaaggtcacggacgcccgggat
gggcagtcgaggacaatccggcagttccagttcacagactggccggagcagggcgtgcct
aagacgggcgagggcttcatcgacttcatcgggcaggtgcacaagaccaaggagcagttc
gggcaggacgggcccatcacggtgcactgcagtgctggtgtgggccgcactggggtgttc
atcacgctgagcattgtcctggagcggatgcgctacgaaggcgtggttgacatgttccag
accgtgaagaccctgcgcacacagcgcccagccatggtgcagacggaggaccagtatcag
ctgtgctaccgcgcggccctggagtacctcggaagctttgaccactatgcaacgtaa

DBGET integrated database retrieval system