KEGG   Bos indicus (zebu cattle): 109556613
Entry
109556613         CDS       T04792                                 

Gene name
PDCD1
Definition
(RefSeq) programmed cell death protein 1 isoform X1
  KO
K06744  programmed cell death protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04660  T cell receptor signaling pathway
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109556613 (PDCD1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    109556613 (PDCD1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109556613 (PDCD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109556613 (PDCD1)
CD molecules [BR:biu04090]
 Proteins
  109556613 (PDCD1)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set
Other DBs
NCBI-GeneID: 109556613
NCBI-ProteinID: XP_019813634
Position
3
AA seq 282 aa
MGTPRALWPLVWAVLQLGCWPGWLLEASSRPWSALTFSPPRLVVPEGANATFTCSFSSKP
ERFVLNWYRKSPSNQMDKLAAFPEDRSQPSRDRRFRVTPLPDGQQFNMSIVAAQRNDSGV
YFCGAIYLPPRTQINESHSAELMVTEAVLEPPTEPPSPQPRPEGQMQSLVIGVTSVLLGV
LLLPPLIWVLAAVFLRATRGGCARRSQDQPPKEGCPSVPAVTVDYGELDFQWREKTPEPV
APCVPEQTEYATIVFPGRRASADSPQGPWPLRTEDGHCSWPL
NT seq 849 nt   +upstreamnt  +downstreamnt
atggggaccccgcgggcgctgtggccactcgtctgggccgtgctrcagctgggctgctgg
ccaggatggctcctagaggcctccagcaggccctggagcgccctcaccttctctcccccc
cggctggtcgtgcccgagggagcgaatgccaccttcacctgcagcttctccagtaagccg
gagcgcttcgtcctcaactggtaccgcaagagccccagcaaccagatggacaaactggcc
gccttccctgaggaccgcagccagcccagccgagaccggcgcttccgcgtcacgccgctg
cccgatgggcagcagtttaacatgagcatcgtggcggcccagcgcaatgacagcggcgtc
tacttctgcggggccatctacctgccaccccggacgcagatcaacgagagccacagcgca
gagctcatggtgacagaggcggtcctggagccgccaacggagccccccagcccccagccc
aggcctgagggccagatgcagagcctggtcatcggcgtcacaagcgtccttctgggggtc
ctgctgctgccgccactgatctgggtcctggccgcggtcttcctcagggccactcgaggg
ggctgcgcccgcaggagccaagaccagcctccgaaggagggctgcccctctgtgccggct
gtcacagtggactacggggagctggacttccagtggcgggagaagaccccggagcccgtg
gctccctgcgtcccggagcagacagagtacgccaccatcgtcttcccaggccgcagggcg
tccgccgacagcccgcaggggccctggccactgaggaccgaggatggacactgctcctgg
cccctctga

DBGET integrated database retrieval system