KEGG   Bos indicus (zebu cattle): 109556725
Entry
109556725         CDS       T04792                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04722  Neurotrophin signaling pathway
biu04750  Inflammatory mediator regulation of TRP channels
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05216  Thyroid cancer
biu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109556725 (NTRK1)
   04014 Ras signaling pathway
    109556725 (NTRK1)
   04151 PI3K-Akt signaling pathway
    109556725 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109556725 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109556725 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109556725 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109556725 (NTRK1)
   05202 Transcriptional misregulation in cancer
    109556725 (NTRK1)
   05230 Central carbon metabolism in cancer
    109556725 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    109556725 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109556725 (NTRK1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109556725 (NTRK1)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   109556725 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 I-set LRR_8 Ig_3 TrkA_TMD Ig_2 LRR_4
Other DBs
NCBI-GeneID: 109556725
NCBI-ProteinID: XP_019813710
Position
3
AA seq 815 aa
MSGEAXQRLLQAHRRLPGRGVAGAVAMLRGGRGGQPGGHLRATGPGSLLAWLMLASAGAA
SCPDVCCPHGPSGLRCTRPGALDNLLHLPGAENLTELYIENQQHLQQLKRSDLRGLGELR
KLTIVKSGLRSVAPNAFHYTPRLGRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSC
ALLWLQRWEEEGRGGVREQKLQCPGQGPLALMSNASCGEPTLKIQMSNASVDVGADVLLQ
CQVEGQGLEQAGWILTELEGSATVMESGSLPSLGLTLANVTSDLNRKNVTCWAENDVGRA
EVSAQVNVSFPASVHLQAAVEQHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLD
LAANETMRHGCLRLNQPTHVNNGNYTLLATNPLGQAAAWVMAAFMDNPFEFNPEDPIPDT
NSTSGDPVEKDETPFGVSMAVGLAVFACLFLSTTFLVLNKCGRRNKFGINRPAVLAPEDG
LAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAF
GKVFLAECHNLLPEKDKMLVAVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTE
GRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYL
AGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILY
RKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPEVYAIMR
GCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgtcgggggaggccyggcagcggctgctgcaagcgcacagacggctgcccggccgcggc
gtggcgggcgccgtcgcgatgctgcgaggcggacggggcgggcaacctggcgggcacctc
cgggctacggggccgggaagcctgctggcctggttgatgctggcatctgcgggcgctgca
tcctgccccgatgtctgctgcccccacggcccttcggggctacgctgcacccggccgggg
gccctggataacctcctccacctgccaggcgccgagaacctgacagagctctacatcgag
aaccagcagcatctgcagcagctgaagcgcagcgacctgaggggcctgggggagctgagg
aaactcaccatcgtgaagagcggtctccgttctgtggcgccaaatgccttccattacact
ccgcggctcggtcgactgaatctctccttcaacgctctggagtctctctcctggaaaacg
gtccagggcctctccttacaggaactagtcctgtcggggaaccccctgcactgttcctgt
gccctgctctggctgcagcgctgggaggaggaggggcggggaggagtgcgggaacagaag
ctgcagtgtcccgggcaggggccccttgccctcatgtccaatgccagctgcggtgagccc
acgctgaagatccagatgtccaatgcttccgtggatgtgggggccgacgtgttgctgcag
tgccaggtggaggggcagggcttggagcaggctggctggatcctcacggagctggagggg
tcagccacagtgatggaatctgggagtctgccgtccttggggctgaccctggccaatgtc
accagtgacctcaataggaagaacgtgacgtgctgggcggagaatgatgtgggccgggct
gaagtctccgcccaagtcaatgtctccttcccggccagcgtgcatctgcaagccgccgtg
gagcagcaccactggtgcatccccttctcggtggacgggcagccagcgccctctctgcgc
tggctcttcaatggctcygtgctcaacgagacctccttcatcttyaccgagttcctggac
ctggcagccaaygagacgatgcgccacggctgcctgcgcctcaaccagcccacccatgtc
aacaacggcaactacacgctgctggcaaccaacccyttgggccaggccgccgcttgggtc
atggccgctttcatggacaaccctttcgaattcaaccctgaggaccccattcctgacacc
aacagcacttccggagacccagtggagaaggatgagactccttttggggtctcaatggct
gtgggcctggccgtttttgcctgyctcttcctttctacaacatttcttgtgctcaacaaa
tgtggacgcaggaacaagtttgggatcaaccgccctgctgtgctggctccggaggatgga
ttggccatgtccttgcatttcatgactctgggtggcagctccttgtctcccactgagggc
aaaggctctgggctccaaggccacatcattgagaacccacartacttcagtgatgcctgt
gttcatcacatcaarcgccgagatatcgtgctcaagtgggagctgggtgagggtgccttt
gggaaggtcttccttgccgagtgccacaacctgctgcctgagaaggacaagatgctagtg
gctgtcaaggcgctraaggaggtgtctgagagcgcccggcaggacttccagcgagaggcc
gagctgctcaccatgctccagcaccagcacatcgtgcgcttcttcggcgtctgcactgag
ggccgcccrctgctcatggtctttgaatacatgcggcacggtgacctcaaccgcttcctc
cggtcccacgggcctgatgccaagctgctggctggtggggaggacgtggctccgggaccc
ctgggcctggggcagctgctggccgtggctagccaggtcgctgcgggaatggtgtacctg
gcaggtctgcacttcgtgcatcgggacctggccacacgcaactgcctggtgggtcaggga
ctagtggttaagatcggcgatttcggcatgagccgggatatctacagcaccgactactat
cgcgtgggaggccgcaccatgctgcccattcgctggatgccgcccgagagcatcctctac
cgcaagttcaccaccgagagcgacgtgtggagcttcggcgtggtgctctgggagatcttc
acctacggcaagcaaccctggtaccagctctccaacaccgaggcgatcgagtgcatcacg
cagggacgtgagctggagcggccgcgtgcttgcccaccggaggtctacgccattatgcgg
ggctgctggcagcgggagccccaacaacgccacagcatcaaggatgtgcatgcccggctg
caagccctggcccaggcgcctcctgtctacttggatgtcctgggctag

DBGET integrated database retrieval system