KEGG   Bos indicus (zebu cattle): 109556918
Entry
109556918         CDS       T04792                                 

Gene name
MASP1
Definition
(RefSeq) mannan-binding lectin serine protease 1 isoform X1
  KO
K03992  mannan-binding lectin serine protease 1 [EC:3.4.21.-]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109556918 (MASP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109556918 (MASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109556918 (MASP1)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109556918 (MASP1)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109556918 (MASP1)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition Trypsin_2 EGF_CA cEGF
Other DBs
NCBI-GeneID: 109556918
NCBI-ProteinID: XP_019813847
Position
1
AA seq 728 aa
MRWLLLSHALCFSLLKASAHIVELNNMFGQIQSPGYPDAYPSDSEVTWNITVPEGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSDEERFTGFDAHYVAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPSPYPKSSECLYTIELEEGFMISLQFEDIFDIEDHPEV
SCPYDYIKIKAGPKVLGPFCGEKAPEPINTQSHSIQILFRSDNSGENRGWRLSYRATGNE
CPKLQPPVHGKIEPLQTTYSFKDQVLISCDTGYKVLKDNVEMDTFQMECLKDGTWSSKIP
TCKIADCGAPAELENGVVTFSTRNNLTTYKSEIRYSCQRPYYKMLHNTTGVYTCSAQGVW
MNEVLGRSQPTCLPVCGQPSRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSESWILTAAHVLRSQRRDNTVTPVSKEHVTVHLGLHDVRDKSGAVNSSAARVV
LHPDFNIQSYNHDIALVQLREPVPLGPHILPVCLPPPEPXGPAPHVLGLVAGWGISNPNV
TVDEIIGSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYXGGKDTC
LGDSGGAFVILDDASQRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPQG
LGELQVER
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgaggtggctccttctctctcatgctctgtgcttctccttgttgaaggcctcagcccac
attgtggagcttaacaacatgttcggccagatccagtctcctggctatccggacgcctat
ccaagtgattcagaggtgacttggaatatcactgttccagagggatttcgaatcaagctt
tacttcatgcacttcaacttggaatcctcctacctttgtgaatacgactatgtgaaggta
gaaactgaagaccaggtgctggcaaccttctgtggcagggagaccacggacacagaacaa
acccctggccaggaagtggttctctcccctggctcctttatgtccatcactttccggtca
gatttctccgatgaagagcgattcacaggatttgatgcccactatgtggctgtggatgtg
gatgagtgcacggagcgggaggacgaggagctgtcctgtgaccactactgccataactac
atcggcggctactactgctcctgtcgcttcggctacattctccacacagacaacaggacg
tgccgagtggagtgcagtgacaacctcttcacccagcggaccggcgtgatcaccagcccc
gacttccccagcccttaccccaagagctccgaatgcctctacaccattgagctagaggag
ggtttcatgatcagcctgcagtttgaggatattttcgacattgaggaccatcctgaggtg
tcctgcccctatgactacatcaagattaaagctggtccaaaagttctggggcccttctgt
ggagagaaagccccagaacccatcaatacccagagccacagcatccagatcctgtttcgc
agtgacaactcgggggagaaccggggctggaggctgtcatacagggcgacagggaatgag
tgccccaagctgcagcctcctgtccatgggaaaatcgaacccttgcaaaccacgtattcc
ttcaaagaccaggtgctcatcagctgtgacacaggctacaaagtgctgaaggataatgtg
gagatggacacattccagatggagtgtctgaaggacgggacgtggagtagcaagattccc
acctgtaaaattgcggactgtggagctccggcagagctggaaaacggagtggtcaccttc
tccaccaggaacaacctcaccacatacaagtctgagatcagatattcctgccagaggccc
tactacaagatgctacacaataccacaggtgtatatacctgttctgcccaaggagtctgg
atgaatgaagtcctggggagaagccagcccacctgcctgccagtgtgcggtcagccctca
cgctcgctgccaaacctggtcaagcggatcattgggggccgcaacgccgagccyggcctc
ttcccgtggcaggccctgattgtggtggaggacacctcaagggtgcccaatgacaagtgg
tttgggagcggggccctgctctccgagtcctggatcctcacggccgcccacgtgctgcgc
tcccagcgcagagacaacacagtgacaccggtctccaaggagcaygtcaccgtccacctg
ggcctgcacgacgtgcgggacaaatccggggctgtcaacagctcggcygcccgagtggtg
ctgcacccggacttcaacatccagagttacaaccatgacatcgccctggtgcagctgcgg
gagcccgtgcccctggggccccacatcctccccgtctgcctgccgccgcccgagcccrca
ggcccggcaccccacgtgctggggctggtagccggctggggcatctccaacccgaacgtg
acagtggacgagatcatcggcagcggcacgcggaccttgtcagacgtcctgcagtatgtc
aagctacccgtggtgccccacgccgagtgcaagaccagctacgagtcgcggtcaggcaac
tayagcgtcaccgagaacatgttctgcgccggctactackagggcggcaaggacacgtgc
ctaggagacagcggtggcgcctttgtcatcctcgacgacgccagccagcgctgggtggcc
caaggcctggtgtcctggggaggccctgaagaatgtggcagcaagcaggtgtatggggtc
tacacgaaggtctccaactatgtggactgggtgtgggagcagatgggttccccgcagggc
ctgggcgagctgcaggtggagcggtga

KEGG   Bos indicus (zebu cattle): 109570390
Entry
109570390         CDS       T04792                                 

Gene name
MASP2
Definition
(RefSeq) mannan-binding lectin serine protease 2 isoform X1
  KO
K03993  mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109570390 (MASP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109570390 (MASP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109570390 (MASP2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.104  mannan-binding lectin-associated serine protease-2
     109570390 (MASP2)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109570390 (MASP2)
SSDB
Motif
Pfam: Trypsin CUB Sushi EGF_CA FXa_inhibition EGF cEGF CUB_2
Other DBs
NCBI-GeneID: 109570390
NCBI-ProteinID: XP_019831870
Position
16
AA seq 686 aa
MRLLVFLGLLWGLVAASSGPQWPKPVFGRLASPGFPDKYANNQERRWALTAPPGYRLRLY
FTHFQLEPSYLCEYDFVKLSAGTKELATLCGSESTDTERAPGNDTFYSPGSSLDVTFRSD
YSNEKPFTGFEAFYSAEDIDECQVPPGEAPTCDHHCHNYLGGFYCSCRVGYVLHRNKRTC
SALCSDQVFTARSGELSSPEYPQPYPKLSSCTYSIHLEEGFHVILDFVESFDVETHPETL
CPYDSLKIRTDKAEYGPFCGKTLPSRIETKSNTVTITFTTDQSGDHMGWKVRYNSTAEPC
PDPLAPPNGRISPVQAKYILKDHFSVFCETGYELLQGNLPLKSFAAVCQKDGSWDRPMPV
CSIVDCGPPDDLPSGQVEYITGPAVTTYRAVVKYRCNEFYTMTTNDGKYVCEADGFWTSS
KREKSLPVCEPVCGISTRTTEGRIYGGQNAKLGYFPWQVLLLGKTMAAGALLYDNWILTA
AHAVYDQREDTASLQIRMGALKRISPNYTQAWAEAIFIHESYIHDAGYDNDIALIKLKNK
VAINSNIMPICLPRKEAESFMRTNDIGTASGWGLTQRGFLARNLKFIDIPVVDHQKCTAA
YEKKSYPDGRVTDNMLCAGLQSGGKDSCRGDSGGALVFLDNETQKWFVGGIVSWGSINCG
EADQYGVYTKVINYIPWIKSIINSNF
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaggctgctggtcttcctgggcctgctgtggggcttggtggctgcgtcctcggggcca
cagtggcccaaaccagtgttcgggcgcctggcatcgcccggcttccccgacaagtacgcc
aacaaccaggagcggcgctgggccctgacggcgccccccggctatcgcctgcgcctctac
ttcacccacttccagctggagccctcctacctgtgcgagtatgactttgtcaagctgagc
gccgggaccaaggagctggccacgctgtgtggctcrgagagcacggacacagagcgggcg
cctggcaacgacaccttctactcaccgggctccagcctggatgtcaccttccgctccgac
tactccaacgagaagccgttcactggctttgaggccttctactctgcagaggacattgac
gagtgccaggtgcccccaggagaggcccccacctgtgaccaccactgccacaactacctg
ggtggcttctactgctcctgccgtgtgggctatgttctccacaggaacaagcgcacctgc
tcagccctgtgttccgaccaggtcttcactgcccggtctggggagctcagcagccctgaa
tacccacagccataccccaaactctccagctgcacctacagcatccacttggaggaggga
ttccacgtcatcttggactttgtggagtcctttgacgtggagacgcaccccgagaccctg
tgcccctacgactccctcaagattcgaacagacaaggcggaatacggcccgttctgtggg
aagacattgcccagcaggattgaaaccaagagcaataccgtgaccatcacctttaccacc
gatcagtcgggggaccacatgggctggaaggtccgatacaacagcacagctgagccttgc
cctgatccattggcgccacctaatggccgcatctcccctgtgcaagccaaatacatcctg
aaagaccacttctccgtcttctgcgagaccggttatgaacttctgcaaggtaacttaccc
ctgaagtcatttgctgcagtctgtcagaaagacgggtcttgggaccgaccgatgccagtg
tgcagcattgtggactgtggccctcctgacgatctacccagtggccaggtggagtacatc
acaggtcctgctgtgaccacatacagggctgtggttaaataccgctgtaatgagttctac
acaatgacaaccaacgatggtaaatatgtgtgtgaggctgatggattctggacgagctcc
aaaagagaaaaatcactcccagtctgtgagcctgtgtgtggaatatccacccgtactaca
gaaggtcgtatatatggaggacaaaatgcaaagcttggttattttccttggcaagtgctg
ttactaggtaaaactatggcagcaggtgcacttctgtacgacaactggatcctaacagct
gctcatgctgtatatgaccaaagggaagacactgcctccctacagattagaatgggtgcc
ctgaagagaatatcacctaattatacacaagcctgggcggaggccatttttatacatgaa
agttacattcatgatgctggttacgataacgacatagcactgattaaactgaagaacaaa
gttgcaatcaacagcaacatcatgcctatttgtttgccaagaaaagaagcagaatctttc
atgaggacaaatgacattggaactgcatctggatggggattaacccaaagagggtttctt
gccagaaatctaaagtttattgacataccagttgttgaccatcaaaaatgtactgctgcc
tacgaaaagaagtcctatccagacggaagggtaactgataacatgctttgtgctggcttg
caaagtgggggcaaggacagctgtagaggtgacagtgggggggcattagtgtttctagat
aatgagacccagaagtggtttgtgggaggaatagtgtcctggggttccattaattgcggg
gaagcagatcagtatggggtctacaccaaagtcataaactacattccctggatcaagagc
atcattaatagtaatttttaa

DBGET integrated database retrieval system