KEGG   Bos indicus (zebu cattle): 109557291
Entry
109557291         CDS       T04792                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8 isoform X1
  KO
K06591  integrin beta 8
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109557291 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109557291 (ITGB8)
   04514 Cell adhesion molecules
    109557291 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109557291 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109557291 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109557291 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109557291 (ITGB8)
   05414 Dilated cardiomyopathy
    109557291 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109557291 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109557291 (ITGB8)
   04515 Cell adhesion molecules [BR:biu04515]
    109557291 (ITGB8)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109557291 (ITGB8)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin beta subunits
   109557291 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 I-EGF_1 Sigma_reg_N
Other DBs
NCBI-GeneID: 109557291
NCBI-ProteinID: XP_019814081
Position
4
AA seq 767 aa
MCRSALVFFTATLVCLQNCRPGPVPFLRAAWMFSVVLGLGQSEDNRCASSNAVSCTKCLA
LGPECGWCAQEDFISGGSKNERCDTVSNLIHKGCSIDLIEYPSVRVMPSENEINTQVTPG
EVLIQLHQGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNVYVRSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVKGIYFNITAICPDGTRKPGTDGCGN
VTSNDEVLFNVTVTMEKCDVTGGKSYAIIKPIGFNETTKIHIHRNCSCQCDDSRGPKRKC
VEETFLDTKCFQCDENKCHIDEDTFPSESCKSHKDQPVCSGRGVCICGKCLCHKIKFGKV
YGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFRGWEGDRCQCPSASAQLCVSPKGQVC
SGRGTCVCGRCECTDPRSIGRFCEHCPTCHTGCSENWNCVQCLHPHNLSQAILDRCKTSC
ALKEQHYVDQTSECLSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNNNKIKSSADY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtgccgctcggccctggttttttttactgccacattagtctgcctgcaaaactgcagg
ccaggtcctgtcccgttcctccgggcggcctggatgttttcagttgttcttggactgggc
caaagtgaagacaatagatgtgcatcttcgaatgcagtgtcctgcaccaagtgccttgcg
ctgggtccggaatgtggatggtgtgctcaagaggatttcatttcaggtggatcaaagaat
gaacgttgtgacactgtttccaatttaatacacaaaggctgctcaattgatttaatagaa
tacccttctgtgcgtgtaatgccaagtgaaaatgaaattaatacccaggtgacaccagga
gaagtgctgatccagctgcatcaaggagctgaagctaattttatgctgaaaattcatcct
ctgaagaaatatcctgtggatctttattatctggttgatgtctcagcatcaatgcacaat
aatattgaaaaattaaattcagttggaaatgatttatctagaaaaatggcatttttctcc
cgtgactttcgccttggatttggctcatacgttgataaaacagtttcaccatacattagt
atccatccagaaagaattcataatcaatgcagtgactacaacttagactgtatgcctccc
catgggtacatccatgtgctgtctttgacggagaacatcactgagtttgaaaaagcagtt
cacagacagaagatctctggaaatatagatacacctgaaggaggttttgatgctatgctt
caggcagctgtctgtgagagtcatattggatggcgaaaagaagctaaaagattgctgctg
gtgatgacagatcagacgtctcatcttgctctcgatagcaaattggcaggcatagtggtg
ccaaatgacggaaactgccatctgaaaaacaacgtctacgtcagatcaacaagcatggaa
catccctcactaggccaactttcagaaaagttaatagacaacaatattaaygtcatcttt
gcagttcaaggaaaacagtttcattggtataaggaccttctacccctcttgcctggcacc
attgctggtgaaatagaatcaaaggctgcaaacctcaataatctggttgtagaagcctat
cagaaactcatttcagaagtgaaagttcaggtggaaaaccaggtaaaaggcatctacttt
aacattactgccatttgtccagatgggaccagaaagccaggcacagacggatgcggaaat
gtgacaagcaatgatgaagttcttttcaatgtaacagttacaatggaaaaatgtgatgtc
acaggaggaaagagctatgcaatcatcaaacctattggtttcaatgaaaccactaaaatt
catatacacagaaattgcagctgtcagtgtgatgacagcagaggacctaaaagaaagtgt
gtagaagaaacttttctagataccaagtgcttccagtgtgatgagaataaatgtcatatt
gatgaggatacatttccttctgaaagttgcaagtcacacaaggatcaacctgtttgcagc
ggtagaggagtttgcatttgtgggaaatgtttatgtcacaaaattaagtttggaaaagtg
tatggaaaatactgtgaaaaggatgacttttcttgtccatatcatcatggaaatctgtgt
gctgggcatggagagtgtgaggccggcagatgccagtgcttcaggggctgggaaggggat
cgctgccagtgcccatctgcatctgcccagctctgtgtcagtccaaagggccaagtgtgt
agtgggagaggcacatgtgtatgtggcaggtgtgagtgcactgatcccaggagcatcggc
cgtttctgtgaacattgtcccacatgtcacacaggctgcagtgaaaactggaattgtgtg
caatgccttcaccctcacaatctgtctcaagctatacttgatcggtgtaaaacttcatgt
gctctcaaagaacagcattatgtggaccaaacatcagaatgcctctctagtccaagctac
ttgagaatatttttcatcattttcatagtcacattcttgattgggttgcttaaagtcctg
atcattagacaggtgatactacaatggaataataataaaattaagtcctcggcagattac
agggtgtcagcctcaaaaaaggacaagttgattctgcaaagtgtttgcacaagagcagta
acctaccgacgtgaaaaacctgaagaaataaaaatggacattagcaaattaaatgctcat
gaaactttcaggtgcaacttctaa

DBGET integrated database retrieval system