KEGG   Bos indicus (zebu cattle): 109557394
Entry
109557394         CDS       T04792                                 

Gene name
NRCAM
Definition
(RefSeq) neuronal cell adhesion molecule isoform X1
  KO
K06756  neuronal cell adhesion molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109557394 (NRCAM)
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY C2-set_2 Ig_C17orf99 Ig_5 SIT INCA1 fn3_2
Other DBs
NCBI-GeneID: 109557394
NCBI-ProteinID: XP_019814251
Position
4
AA seq 1199 aa
MQLKIMPKKKCLSAGRAPLMLFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVI
QCEAKGKPSPSFSWTRNGTHFDIEKDPLVTMKPGSGTLTINIMSEGKAETYEGVYQCTAR
NERGAAISNNIVIRPSRSPLWTKEKLEPIILRNGQSLVLPCRPPIGLPPPIIFWMDNSFQ
RLPQSERVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVISVDELND
TIAANLSDTEFYGAKSHRQRPPTFLTPDGNTSRKEELRGNVLSLECIAEGLPTPIIYWIK
EDGTLPINRTFYRNFKKTLQIVQVTEADSGNYQCIAKNALGAIHHTISVTVKAAPYWIIA
PQNLVLSPEEDGTLICRANGNPKPRISWLSNGVPIEIAPDDPSRKIDGDTIIFSKVQERS
SAVYQCNASNEYGYLLANAFVNVLAEPPRILTSANTLYQVIANRPALLDCAFFGSPLPTI
EWFKGAKGSALREDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNDVHLEIKDPT
RIIKQPEYAVVQRGSTVSFECKVKHDHTLIPTVMWLKDHGELPNDGRFTVDKDRLVVADV
NDDDGGTYTCVANTTLDNVSASAVLSVVDVPNPPFDLELTDQLDRSVQLSWTPGDDNNSP
ITKFIIEYEDAMHEPGLWHHQTEVPGTQTTAQLKLSPYVNYSFRVMAENNLGRSLPSEAS
EQYLTKAAEPDKNPTAVEGLGSEPDNLVITWKPLNGFESNGPGLQYKVSWRQKDGDDEWT
SVVVANVSKYIVSGTPTFVPYLIKVQALNDAGFAPEPAAVMGHSGEDLPMVAPGNVRVNV
VNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKAQSSLTRNRRHIEKKILTFQGSKTHGMLP
GLEPFSHYTLNVRVVNGKGEGPASPDKVFNTPEGVPSAPSSLKIVNPTLDSLTLEWEPPS
HPNGILTEYTLKYQPINSTHELGPLVDLKIPANKTRWILKNLNFSTRYKFYFYAQTAAGS
GIQITEEAITTVDEAGILPPDVGAGKAMASRQVDIATQGWFIGLMCAVALLILILLIVCF
IRRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYRSLESDAEDHKPLKKGSRTPSDRT
VKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV
NT seq 3600 nt   +upstreamnt  +downstreamnt
atgcagcttaaaataatgccgaaaaagaagtgcttatctgcaggcagagcgccgctgatg
ctcttcctgtgccagatgattagtgccctggaagtccctcttgatctggtgcaaccacca
accatcactcaacagtctccaaaagattacattattgaccctcgagagaatattgtaatc
cagtgtgaggcaaaggggaaaccttctccaagcttttcctggacccgaaatgggactcat
tttgacatagaaaaagaccctctcgtcaccatgaagcctggctcaggaaccctcacaatc
aacatcatgagcgaggggaaagcagagacctatgaaggagtctatcagtgtacagccagg
aacgaacgcggggctgcgatttctaataacattgtcatccgtccatccaggtcaccgtta
tggaccaaagaaaagcttgaaccaataatacttcgaaatggccagtctttggtccttccc
tgcagaccaccaattgggttgccaccacccataatattctggatggataattcctttcaa
agacttccccagagtgagagagtttcccaaggtctgaatggagacctgtacttttccaat
gtgctcccagaggacacccgggaagactacatctgttacgccagatttaatcacactcaa
accatacagcagaagcaaccaatttctgttaaggtgatttcagtggatgaattgaatgac
actatagctgctaatttgagtgacactgagttttatggtgctaaatcacatagacagagg
ccaccaacatttttaactccagacggcaatacaagtcgcaaagaagagttaagaggaaat
gtcctttcccttgagtgcatcgcagaagggctgcctaccccaattatttactggataaaa
gaagatggaacactccccatcaatcggacattttataggaactttaagaaaactctgcaa
atcgttcaggttacagaagcagactctggaaattaccagtgtatagccaaaaatgcatta
ggagccatccatcataccatttccgtcacagttaaagcggctccatactggatcatagca
cctcaaaatcttgtgctgtcccctgaagaggatggaaccctcatctgcagagcgaatggc
aacccaaaacccagaattagctggttatcaaatggagtcccgatagaaattgcccctgat
gaccccagcagaaaaatagatggtgacaccattattttttccaaagttcaagaaagatca
agtgcagtgtatcagtgcaatgcctctaacgaatatggatatttactggcaaatgcattt
gtaaatgtgctggctgagccaccacgaatccttacatctgcaaacacactctatcaggtc
attgcaaacagacctgccttactggactgtgccttctttgggtctcctctgcctaccatc
gagtggtttaagggcgctaaagggagtgctcttcgtgaagatatttatgttttacatgaa
aatggaactttggaaattcctgtggcccagaaggacagtacaggaacctatacatgtgtc
gcacggaataagttaggaatggcaaagaatgatgttcacctggaaatcaaagatccaaca
aggatcattaaacagcctgaatatgcagttgtgcaaagagggagcactgtgtcctttgaa
tgcaaagtgaaacacgatcacaccttaatccccactgtcatgtggctcaaagaccatggg
gagctgcccaatgatggaaggttcaccgttgacaaggaccgtttggtggtcgctgatgtc
aacgatgatgatggtgggacctacacatgtgtggccaacacaactctggacaacgtttcg
gccagcgctgtgcttagcgttgtcgatgtcccaaatcctccctttgatttagaattgaca
gatcaactggacaggagtgttcagctatcatggaccccaggcgatgacaacaatagtcct
attacaaaattcatcattgagtatgaagatgcaatgcatgagccagggctgtggcaccac
caaactgaagttcctggaacrcagaccacagcccagctgaagctgtcgccctatgtcaac
tattccttccgagtgatggcggaaaacaacctggggaggagtctgcccagcgaggcatct
gagcagtatttgactaaagctgcagaacctgataaaaatcccacagctgtggaagggctg
ggatcagagccagataatttggtgattacatggaagcccttgaatggttttgaatctaat
gggccaggccttcagtacaaagttagctggcgccagaaggatggcgatgatgaatggacg
tctgtggttgtggcaaatgtatccaaatacattgtctcgggcaccccaacctttgttcca
tacctgatcaaagttcaggccctgaacgatgcagggtttgccccagagccagctgcggtc
atgggacattctggagaagacctcccaatggtggctccagggaatgtgcgtgtcaacgtg
gtaaacagcaccttagctgaggtgcactgggaccctgtacctctgaaaagtatccgagga
cacctgcagggctatcggatttactactggaaggcgcagagttcattgacaagaaacaga
cgccatattgaaaagaagatccttactttccagggcagcaagactcacggcatgttgcct
gggctggagccctttagccactacacactgaatgtccgtgtggtcaatgggaaaggggag
ggcccagccagccctgacaaggtcttcaatactccggaaggagtccccagcgctccgtcc
tctttgaagattgttaatccaacgctagattctctcactttggaatgggagccaccaagc
cacccgaatggcattttgacagagtataccttaaaatatcagccaattaatagcacacat
gaattaggccctctggtagatctgaaaattcctgccaacaagacccgctggattttaaaa
aatttaaatttcagcactcggtataagttttatttctatgcgcaaacagcagcaggatca
ggaattcaaataacagaagaagcaataacaactgtggatgaagctggtattctcccacct
gatgtaggtgcaggcaaagcgatggcaagccggcaagtggatatagcaactcagggctgg
ttcattggtctaatgtgtgctgtcgctctcctgatcttaattttgctgattgtttgcttc
atcagaagaaacaaaggtggtaaatatccagttaaagaaaaggaagatgcccacgcagat
cctgaaatccagcctatgaaggaagatgatggcacttttggagaatacaggtctcttgaa
agtgatgcggaagaccacaagcctttaaaaaaaggcagtcgaacaccttcagacaggact
gtgaaaaaggaagatagcgatgatagcctagttgactatggagagggagtgaatggccag
ttcaatgaggacggctcctttatcggacagtacagtggtaagaaagagaaagaaccagct
gaaggaaacgaaagctcagaggcaccatctcctgtcaacgccatgaattcatttgtctga

DBGET integrated database retrieval system