KEGG   Bos indicus (zebu cattle): 109557445Help
Entry
109557445         CDS       T04792                                 

Gene name
AOAH
Definition
(RefSeq) acyloxyacyl hydrolase
  KO
K01065  acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109557445 (AOAH)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     109557445 (AOAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL SapB_2 Lipase_GDSL_2 CLU_N
Motif
Other DBs
NCBI-GeneID: 109557445
NCBI-ProteinID: XP_019814324
Position
4
AA seq 575 aa AA seqDB search
MKSPXKLIMAAPVFFLLTLHTLASSGYGNWPDTRHSNGHACIGCVLVVSMIEQLTQVHNS
TVQISMERLCSYLPEKLFLKTTCYLVVHIFGPDITKLFRADMNADVVCHTLEFCKQDPGQ
PLCHLYPLPKEAWTFTLEKARQIVKXSPALTYSRSGAGICSLPFLAKICQKIKLSIQNSV
PFKDADSDKYSDFPTLRGFYWRGRDCNDSNKMAYPGRRPDNWDSYQDSNCNGIWGVDPKD
GIPYEKKFCEGSQPRGVILLGDSAGAHFHIPPDWITASQMSLKSFLNLPIALTNELDWPQ
LSGTTGFLYSTSRIKENSIYLRLRKRNHCNHRDYQNISKNGASSQNLERFIESLSRNQLL
DYPAIVIYAMIGNDVCSGNIDPLPEMTTPEKLYSKVMQTLQYLDSHLPNDSHVILYGLPD
GRFLWDHLHDRYHPLGQLNKDVTYAHFYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQL
SKTLKKIATSQKFTNFDLFYLDFDFQEITEEWQRRGGQPWQLIEPVDGFHPNEVVLQLLA
DHFWKKMQHQWPHVLGKENPFNPQIEQVFGDQGGH
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcctyggaaactcattatggctgctcctgtgttttttctcctgacccttcac
accttggcctcttcaggctatggcaactggcctgacaccagacactccaatggccatgcc
tgcataggttgtgtgctggtggtgtctatgattgaacagctcactcaagttcacaactcg
acagtccagatctcaatggagagactgtgcagctacttgcctgaaaaactgttcttgaag
accacttgctatttagtggtacatatatttggaccagacatcacaaaactattcagagca
gatatgaatgctgatgtggtgtgtcacaccctggagttttgtaaacaggatcccggccaa
cccttgtgtcacctctatccccttcccaaggaggcatggacatttacacttgagaaggcc
agacagattgtcaagaratctccagctctgacgtactccagaagtggtgctggtatttgt
tcactcccatttttggccaagatctgtcagaagattaaactaagtatacaaaattctgtg
ccattcaaagatgccgattcagacaaatatagtgatttcccaacactgcggggcttttat
tggcgagggagagattgcaacgacagcaacaagatggcrtacccaggcagaaggccagac
aactgggactcatatcaagattcaaactgtaacggcatttggggtgttgatccaaaagat
ggaatcccatacgagaagaaattctgtgaaggttcacagcccaggggagtcattttgctg
ggggactcagctggggctcatttccacatccctcctgactggatcacagcttcgcagatg
tctttgaaatccttcctcaatttaccaatagctcttaccaatgagcttgactggccccag
ctatctggtactactggatttctgtactccaccagcagaattaaagaaaactctatttac
cttcgtttacggaaaagaaaccactgcaatcacagggactatcagaatatttcaaaaaat
ggtgcatcctcccaaaacctggagagatttatagaaagtttatctaggaaccagctgttg
gattatccagccattgtcatatatgccatgattggaaatgatgtctgcagtgggaatatt
gatcctctcccagaaatgaccactcctgagaaattgtactccaaggtcatgcagactctg
cagtatctagattcccacctgccaaatgacagtcatgttattttatatggcttaccagat
ggaagatttctctgggatcatttgcatgacagatatcatcctcttggccagctcaacaag
gacgtgacctacgcgcacttctactccttcctcaactgtctccaggtcagcccctgccac
ggctggatgtcttccaacaagacgctgcggactctcacttcagagagagcagaacaactc
tccaaaacgctgaaaaaaattgcaaccagccagaaatttacaaacttcgaccttttctac
ttagatttcgacttccaagaaatcacggaggagtggcaaaggagaggtgggcagccctgg
cagctcatcgaacctgtggatggatttcaccctaatgaggtggttttacagctgttggca
gatcacttctggaagaagatgcagcaccagtggccccacgtcctgggaaaggagaatcca
ttcaatccgcagattgagcaggtgtttggagaccaaggsgggcactga

DBGET integrated database retrieval system