KEGG   Bos indicus (zebu cattle): 109557512
Entry
109557512         CDS       T04792                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05132  Salmonella infection
biu05134  Legionellosis
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05222  Small cell lung cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109557512
   04215 Apoptosis - multiple species
    109557512
   04115 p53 signaling pathway
    109557512
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109557512
  09162 Cancer: specific types
   05210 Colorectal cancer
    109557512
   05222 Small cell lung cancer
    109557512
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109557512
   05012 Parkinson disease
    109557512
   05014 Amyotrophic lateral sclerosis
    109557512
   05016 Huntington disease
    109557512
   05017 Spinocerebellar ataxia
    109557512
   05020 Prion disease
    109557512
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109557512
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109557512
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109557512
   05134 Legionellosis
    109557512
   05152 Tuberculosis
    109557512
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109557512
   05162 Measles
    109557512
   05164 Influenza A
    109557512
   05161 Hepatitis B
    109557512
   05160 Hepatitis C
    109557512
   05168 Herpes simplex virus 1 infection
    109557512
   05163 Human cytomegalovirus infection
    109557512
   05167 Kaposi sarcoma-associated herpesvirus infection
    109557512
   05169 Epstein-Barr virus infection
    109557512
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109557512
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109557512
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109557512
NCBI-ProteinID: XP_019814436
Position
4
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag
acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg
ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag
atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa
aaagctaccaatgagtaa

KEGG   Bos indicus (zebu cattle): 109566483
Entry
109566483         CDS       T04792                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05132  Salmonella infection
biu05134  Legionellosis
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05222  Small cell lung cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109566483
   04215 Apoptosis - multiple species
    109566483
   04115 p53 signaling pathway
    109566483
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566483
  09162 Cancer: specific types
   05210 Colorectal cancer
    109566483
   05222 Small cell lung cancer
    109566483
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109566483
   05012 Parkinson disease
    109566483
   05014 Amyotrophic lateral sclerosis
    109566483
   05016 Huntington disease
    109566483
   05017 Spinocerebellar ataxia
    109566483
   05020 Prion disease
    109566483
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109566483
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109566483
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109566483
   05134 Legionellosis
    109566483
   05152 Tuberculosis
    109566483
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109566483
   05162 Measles
    109566483
   05164 Influenza A
    109566483
   05161 Hepatitis B
    109566483
   05160 Hepatitis C
    109566483
   05168 Herpes simplex virus 1 infection
    109566483
   05163 Human cytomegalovirus infection
    109566483
   05167 Kaposi sarcoma-associated herpesvirus infection
    109566483
   05169 Epstein-Barr virus infection
    109566483
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109566483
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109566483
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109566483
NCBI-ProteinID: XP_019826447
Position
11
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag
acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg
ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag
atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa
aaagctaccaatgagtaa

KEGG   Bos indicus (zebu cattle): 109566484
Entry
109566484         CDS       T04792                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05132  Salmonella infection
biu05134  Legionellosis
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05222  Small cell lung cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109566484
   04215 Apoptosis - multiple species
    109566484
   04115 p53 signaling pathway
    109566484
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566484
  09162 Cancer: specific types
   05210 Colorectal cancer
    109566484
   05222 Small cell lung cancer
    109566484
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109566484
   05012 Parkinson disease
    109566484
   05014 Amyotrophic lateral sclerosis
    109566484
   05016 Huntington disease
    109566484
   05017 Spinocerebellar ataxia
    109566484
   05020 Prion disease
    109566484
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109566484
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109566484
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109566484
   05134 Legionellosis
    109566484
   05152 Tuberculosis
    109566484
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109566484
   05162 Measles
    109566484
   05164 Influenza A
    109566484
   05161 Hepatitis B
    109566484
   05160 Hepatitis C
    109566484
   05168 Herpes simplex virus 1 infection
    109566484
   05163 Human cytomegalovirus infection
    109566484
   05167 Kaposi sarcoma-associated herpesvirus infection
    109566484
   05169 Epstein-Barr virus infection
    109566484
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109566484
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109566484
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 109566484
NCBI-ProteinID: XP_019826448
Position
11
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccatggtctgtttggacgaaag
acaggtcaggctcctggattctcttacacagatgccaataagaacaaaggtatcacctgg
ggagaggagacgctgatggagtacttggagaatcccaagaagtacatccctggaacaaag
atgatctttgctggcattaagaagaagggagagagggaagacttgatagcttatctcaaa
aaagctaccaatgagtaa

DBGET integrated database retrieval system