KEGG   Bos indicus (zebu cattle): 109557747
Entry
109557747         CDS       T04792                                 

Gene name
CASP2
Definition
(RefSeq) caspase-2 isoform X1
  KO
K02186  caspase 2 [EC:3.4.22.55]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109557747 (CASP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109557747 (CASP2)
   01002 Peptidases and inhibitors [BR:biu01002]
    109557747 (CASP2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.55  caspase-2
     109557747 (CASP2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109557747 (CASP2)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C14: caspase family
   109557747 (CASP2)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 109557747
NCBI-ProteinID: XP_019814782
Position
4
AA seq 452 aa
MAAPSAGFQYPLQPKEQMAADRGRRMLRGCGMHPDHQEALKKNRVVLAKELLLSELLEHL
LEKDIITLEMREHIQAKTGSFGQNVELLNLLPKRGPQAFDAFCVALRETKQSHLEELLLR
TLSGLQPVVPPLSCDYDLSLPFPVCESCTRHKRLHLSPDAVEHSLDHGDGPPCLQVKPCT
PEFYQTHHHLAYRLQSRPRGLALVLSNVHFTGEKDLEFRSGGDVDHSTLVTLFKLLGYKV
HVLLDQTAQEMQEKLQNFAQLPVHRVTDSCIVALLSHGVEGGVYGVDGKLLQLQEVFRLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDLQDGKNHDRSPKCEESDASREELLKMRLPT
RSDMICGYACLRGTAAMRNTKRGSWYVEALTQVFSERACDMHVADMLVKVNALIKEREGY
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcggcgccgagcgcgggcttccagtaccccctccagccaaaggagcagatggccgct
gatagggggcgcaggatgttgagagggtgtggcatgcatcctgaccatcaggaagctctc
aaaaagaaccgagtggtgttggccaaagagctgctgctgagtgaactgttggaacacctc
ctagagaaggacattatcaccttggaaatgagagagcacattcaggccaagactggcagt
ttcggccagaacgtggaactcctcaacttgctgcccaagagaggcccccaggcctttgat
gccttctgtgtggccctgagggagaccaagcagagtcacctggaggagctgctgctcaga
accctgtctggtcttcagcctgtagtcccgccgttgagctgtgactatgacctgagtctc
cctttcccggtgtgtgagtcctgtacccgccacaagcggctccacctgtctccagatgca
gtggagcactccctagaccacggagatggtcctccctgccttcaggtgaagccctgcacg
cctgagttttatcaaacacaccaccacctggcctaccggttgcagtctcggccccgcggc
ctggcactggtgctgagcaacgtacacttcactggagagaaagacctggagttccgctct
ggaggggatgtggaccacagcactctcgtcaccctcttcaagctcttgggctacaaagtt
cacgttcttcttgaccagaccgctcaggaaatgcaagagaaactgcagaattttgcccag
ctcccggttcaccgagtcactgactcctgcatagtggcactcctctcccacggcgtggag
ggcggcgtctacggcgtggacggcaaactgctccagctacaagaggtttttcggctcttt
gacaatgccaactgcccaagcctacagaacaaaccgaaaatgttcttcatccaggcctgc
cgtggagatgaaacagatcgtggggtcgacctgcaagacgggaagaaccatgaccgatcc
cccaartgygaggagagygatgccagcagagaggagctgctgaagatgcggctgcccacc
cgctcagacatgatttgtggctacgcctgcctcagagggaccgctgccatgcgcaacacc
aagcggggctcctggtacgtggaggccctcacccaggtgttctccgagagggcctgtgac
atgcacgtggccgacatgctggtgaaggtgaacgcgctcatcaaggagcgagaaggctac
gccccaggcacggagttccaccgctgcaaggagatgtccgagtactgtagcaccctgtgc
cgccacctctacctcttcccgggccacccccccacgtga

DBGET integrated database retrieval system