KEGG   Bos indicus (zebu cattle): 109557835
Entry
109557835         CDS       T04792                                 

Gene name
LRRC4
Definition
(RefSeq) leucine-rich repeat-containing protein 4
  KO
K16351  netrin-G2 ligand
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04360  Axon guidance
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109557835 (LRRC4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    109557835 (LRRC4)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 LRR_1 LRR_9 V-set ig LRRNT Ig_6 Ig_2 DAG1 Insulin_TMD
Other DBs
NCBI-GeneID: 109557835
NCBI-ProteinID: XP_019814945
Position
4
AA seq 562 aa
SRRKCVILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLM
ENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAF
EYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNL
GMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLGSLKKLWVMNSQVSLIERNAFD
GLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNS
TCCGRCHAPLHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVK
WLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVST
AELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQ
VAVTATDTNDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTVTAA
RTVEIIRTNLSGQSGNYAVAVK
NT seq 1689 nt   +upstreamnt  +downstreamnt
tcacggcgcaagtgtgtgattctgtgtgcagccatcgctgctgctgcctccgccgggccc
cagaactgcccatccgtctgctcgtgtagtaaccagttcagcaaggtggtgtgcacccgc
cggggcctctccgaggtccctcaggggattccttccaacacccggtacctcaacctcatg
gagaacaatatccagatgattcaggccgacaccttccgccacctccaccacctggaggtc
ttgcagctgggcaggaactccatccggcagatagaggtgggggccttcaacggcctggcc
agcctcaacaccctggagctgttcgacaactggctgacggtcattcccagcggggccttc
gaatacctgtccaagctgcgggagctctggctgcgcaacaaccccatagagagcatcccc
tcttatgccttcaaccgggtgccctccctcatgcgcctggacctgggggagctcaagaag
ctggagtacatctccgagggggcctttgagggactgttcaacctcaagtacctgaacttg
ggcatgtgcaacatcaaggacatgcccaacctcaccccgctcgtggggctggaggagctg
gagatgtcggggaaccacttcccggagatcaggcctggctccttccatggcctcggctcc
ctcaagaagctatgggtcatgaactcacaagtcagcctgattgagcggaatgcttttgat
gggctggcctcgctggtggaactcaacctggcccataataacctctcttctttgccccat
gacctcttcacccccctgaggtacctggtggagttgcacctacaccacaatccttggaac
tgtgattgtgacattctctggctagcctggtggcttcgggagtacatacccaccaactcc
acctgctgtggccgctgccacgctcccttgcacatgcgaggccgctacctggtggaggtg
gaccaggcctccttccagtgctccgcccccttcatcatggatgcccctcgggacctcaat
atctcggagggtcggatggcggaacttaagtgtcggactccccccatgtcctctgtgaag
tggttgytgcccaatgggacagtgctcagccacgcctcccgccacccacggatctccgtc
ctcaacgacggcaccttgaacttttcccacgtgctgctctcagacacaggggtatacacg
tgcatggtgaccaatgtggcgggcaactccaatgcctcggcctacctcaacgtgagcacg
gccgagctcaacacctccaactacagcttcttcaccacggtcacagtggagaccaccgag
atctcgcccgaggacacaacgcgcaagtacaagcctgttcctacgacgtccactggttac
cagccggcttataccacctctaccacggtgctcatccagaccacccgtgtgcccaagcag
gtggcagtgaccgcgacggacaccaacgacaagatgcagaccagcctggatgaagtcatg
aagaccaccaagatcatcatcggctgctttgtggcagtgaccctgctcgctgctgccatg
ctgattgtcttctataaacttcgcaagcggcaccagcagaggagtacagtcacagccgcc
cggacagttgagattatccgaactaatctctctgggcagtcagggaactatgcagttgct
gtgaaatga

DBGET integrated database retrieval system