KEGG   Bos indicus (zebu cattle): 109558018
Entry
109558018         CDS       T04792                                 

Gene name
TNFSF10
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 10 isoform X1
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04068  FoxO signaling pathway
biu04210  Apoptosis
biu04217  Necroptosis
biu04650  Natural killer cell mediated cytotoxicity
biu05132  Salmonella infection
biu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109558018 (TNFSF10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109558018 (TNFSF10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109558018 (TNFSF10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109558018 (TNFSF10)
   04217 Necroptosis
    109558018 (TNFSF10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109558018 (TNFSF10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109558018 (TNFSF10)
  09172 Infectious disease: viral
   05164 Influenza A
    109558018 (TNFSF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109558018 (TNFSF10)
   04052 Cytokines and growth factors [BR:biu04052]
    109558018 (TNFSF10)
   04090 CD molecules [BR:biu04090]
    109558018 (TNFSF10)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109558018 (TNFSF10)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Tumor necrosis fators
   109558018 (TNFSF10)
CD molecules [BR:biu04090]
 Proteins
  109558018 (TNFSF10)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 109558018
NCBI-ProteinID: XP_019815068
Position
1
AA seq 287 aa
MALKQAPGSRLGQICMPILIFTVLLQAFGMAVFYMYFNKELKQMQNKYFKSGLACFLEED
DRSWDSRDDESIINPCWELKSQLYLFVKKMTLRTFEEMIPTNPEKQYNPYLEREKGPKRV
AAHITGSNRKKSTLPVPGSKNEKAVGHKINSWESSRKGHSFLNNLYLRNGELVILQTGFY
YIYSQTYFRFQEPEEVLGTVSTEENRKKIKQMVQYIYKYTNYPDPILLMKSARNSCWSKD
SEYGLYSIYQGGIFELKENDRIFVSVTNERLVDLDQEASFFGAFLIG
NT seq 864 nt   +upstreamnt  +downstreamnt
atggccctgaagcaggctccgggctccagacttgggcagatctgcatgccgatcctcatc
ttcacagtgctgctgcaggcttttggtatggccgtgttttacatgtatttcaacaaagag
ctgaagcagatgcagaacaaatacttcaaaagtggcttggcttgcttcttggaggaagat
gaccgttcctgggactccagagatgatgagagtataatcaatccctgctgggaactaaag
tcccaactctatctgtttgttaaaaagatgactttgagaacctttgaggaaatgattcct
acaaatccagaaaagcaatataatccttacctagagagagaaaagggtcctaagagggta
gctgctcatataactggaagcaatcggaaaaaaagtacgttgccagttccaggctccaag
aatgaaaaagctgtgggccataaaataaattcctgggagtcatcaagaaaaggacattcr
ttcttgaataatttgtacttaaggaatggagagctggttatccttcaaacaggattttat
tacatctattcccaaacatactttcgatttcaggaacctgaggaagttttgggaactgtt
tcaacagaagagaacagaaaaaaaatcaaacaaatggtacaatatatttacaaatacaca
aactatcctgaccctatactgctgatgaaaagtgctagaaatagttgttggtctaaagat
tcagaatatggactctattccatctatcaaggaggaatatttgagcttaaggaaaatgat
cgaatttttgtctctgtaactaatgaacgattggttgacctggaccaagaagccagtttt
ttcggagcctttttaattggctaa

DBGET integrated database retrieval system