KEGG   Bos indicus (zebu cattle): 109558029
Entry
109558029         CDS       T04792                                 

Gene name
CNTNAP2
Definition
(RefSeq) contactin-associated protein-like 2
  KO
K07380  contactin associated protein-like 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109558029 (CNTNAP2)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 F5_F8_type_C COLFI EGF hEGF Syndecan
Other DBs
NCBI-GeneID: 109558029
NCBI-ProteinID: XP_019815076
Position
4
AA seq 1268 aa
MPGARGARCGAALWLGLLGGIFCRAWTAPATSQKCDEPLVSGLHHAAFSSSSSMSGSYSP
GYAKINKRGGKAFPGNVNSDSVVRHDLQHPVIARYVRFVPLDWNGEGRIGLRIEVYGCSY
WADVINFDGHVVLPYRFRNKKMKTLKDVIALKFKTSESEGVILHGEGQQGDYITLELKKA
KLVFSLNLGSNQLGPIYGHTSVMTGSLLDDHHWHSVVIERQGRSINLTLDRSTQHFRTNG
EFDYLDLDYEITFGGIPFSGKPSSSSRKNFKGCMESINYNGINITDLARRKKLEPSNVGN
LSFSCVEPYTVPVFFNATSYLEVPGRLHQDLFSVSFQFRTWNPNGLLLFSHFADNLGNVE
IDLTESKVGVHINVTQTKMNQIDISSGSGLNDGQWHEVRFLAKENFAVLTIDGDEASAVR
TNSPLQVKTGEKYFFGGYLNQMNNSSHSVLQPSFQGCMQLIQVDDQLVNLSEVAQRRPGS
FANVSIDMCAIIDRCVPNHCEHGGKCSQTWDSFKCTCDETGYSGATCHNSIYEPSCEAYK
HLGQTSNYYWIDPDGSGSLGPLKVYCNMTEDKVWTIVSHDLQMQTTVVGYNPEKYSVTQL
IYSASMDQISAITSSAEYCEQYVSYFCKMSRLLNTPDGSPYTWWVGKANEKHYYWGGSGP
GIQKCACGIERNCTDPKYYCNCDADYKQWRKDAGFLSYKDHLPVSQVVVGDTDRQGSEAK
LSVGPLRCQGDRDYWNAASFPNPSSYLHFSTFQGETSADISFYFKTLIPRGVFLENLGNT
DFIKLELKSATEVSFSFDVGNGPVEMVVRSPTPLNDDQWHRVTAERNVKQASLQVDRLPQ
QVRKAPTEGHTRLELYSQLFVGGAGGQQGFLGCIRSLRMNGVTLDLEERAKVTSGFKSGC
SGHCTSYGANCENGGKCIEKYHGYSCDCSNTAYDGTFCNKDVGAFFEEGMWLRYNFQAPG
IGTRDSGSRSENSPDPQNGAPDLAGEEIRFSFSTTKAPCILLYVSSFTTDFLAALVKPTG
SLQVRYNLGGTREPYNIDVDHRSMANGQPHSVNITRRERTITLKLDHYPSVSYHLPSSSD
TLFNSPKSLFLGKVIETGKIDQEIHTYNTPGFTGCLSRVQFNQIAPLKAALRQTNASAHV
HIQGELVESNCGASPLTLSPMSSATDPWHLDHLDSASADFPYNPGQGQAIRNGVNRNSAI
IGGVIAVVIFTILCTLVFLIRYMFRHKGTYHTNEAKGAESAESADAAIMNNDPNFTETID
ESKKEWLI
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgcccggggctcggggagcccgctgcggggcagcgctgtggctcgggctgctcggcggc
atcttctgcagagcctggacggctcccgccacgtcccaaaaatgtgatgagccccttgtg
tctggactacaccatgcagctttcagcagctcatcctccatgtctgggagctattcacct
ggctatgccaagatcaacaagcgagggggtaaggcatttcctgggaacgtcaactctgat
agtgttgtccggcacgatttacagcatcctgtcatcgcccgctatgtccgctttgtgcct
ctggattggaacggagaaggccgcattgggctcaggattgaggtctatggctgttcttac
tgggctgatgttatcaacttygatggccatgttgtgttaccatatagattcagaaacaag
aagatgaaaacactgaaagatgtcattgccttgaaatttaaaacttctgaaagtgaaggg
gtaatcttacacggggaaggacagcaaggggattatattactttggaactcaaaaaagcc
aagctggtcttcagtttaaacctaggaagcaaccagcttggccccatatayggccacacg
tccgtgatgacaggaagcctgctggatgatcaccactggcactctgtggtcattgagcgc
cagggccggagcatcaacctcaccctggacagaagcacacagcacttccgcaccaacggg
gagttygactacctggatttggactatgagataacctttggaggcatacctttctctgga
aaaccaagttccagcagtagaaagaatttcaaaggctgcatggaaagcattaactacaat
ggcatcaacataacagatctggcragaaggaagaaactggagccctcaaatgtgggaaat
ttgagtttctcgtgtgtggagccttacacagtacctgtctttttcaacgctaccagttat
ctggaggtgcccggacggcttcaccaggacctgttttcggttagcttccagttcaggact
tggaaccccaatggtctcctgcttttcagtcattttgcagataacttgggcaacgtggaa
attgacctcactgagagcaaagtcggtgttcacatcaacgtcacgcagaccaagatgaac
cagatagacatctcgtcaggttctgggttgaatgatggccagtggcatgaggtccgtttc
ctagctaaggagaattttgctgttctcactatcgatggagatgaagcctcagcagttcga
actaacagtcctcttcaagttaaaactggcgaaaagtactttttcggaggttatctgaac
cagatgaataactcaagtcactctgtccttcagccttcattccaaggatgcatgcagctc
attcaagtggatgatcaacttgtaaatttatccgaagtggcgcaaaggaggcctggaagt
tttgcaaatgtcagcattgacatgtgtgccatcatagacagatgtgtgcccaatcactgt
gagcatggtgggaagtgctctcaaacatgggacagcttcaaatgcacttgcgatgagact
ggatacagtggggccacctgccacaactccatctatgagccttcctgtgaagcatacaaa
cacctgggccagacctcaaattactactggatagatcccgatggcagtggatcactgggg
cctctgaaagtttactgcaacatgacagaggacaaagtatggaccatcgtgtctcacgat
ttgcagatgcagacgacggtggtgggctacaacccagaaaaatactcggtaacgcagctc
atatacagcgcctccatggaccagatcagcgccatcaccagcagcgccgagtactgtgag
cagtatgtctcctatttctgcaagatgtcgaggttgttgaacaccccagatggaagccct
tacacctggtgggttggcaaagccaacgagaagcactactactggggaggctctgggcct
ggaatccagaaatgtgcctgcggcatcgagcgcaactgcacagaccccaaatactactgc
aactgtgacgcggattacaagcagtggagaaaggatgctggtttcttatcctacaaagat
cacctgccagtcagccaggtggtggttggagataccgaccggcaaggctcagaagccaag
ctgagtgtgggtcccctgcgctgccaaggagacagggattactggaatgcggcctctttc
ccaaacccatcatcctacctgcatttctccactttccaaggagagaccagtgccgacatc
tccttctacttcaaaacgctaatcccccgcggagtgtttcttgaaaatctggggaacaca
gatttcatcaaactcgaactgaaatctgccacagaagtgtccttttcatttgacgttggg
aatgggccagtggagatggtggtgaggtcgcccaccccactcaacgatgaccagtggcac
cgggtcaccgccgagaggaacgtcaagcaggccagcctgcaggtggaccgtctgccacag
caggtccgcaaggccccgacagaaggccacacccgcctggagctctacagccagctgttt
gtgggtggtgctggaggccagcagggcttcctgggctgtatccgctccctaaggatgaat
ggggtgactctggacttggaagagagagccaaggtcacatctggtttcaaatcygggtgc
tcagggcactgcaccagctacggagccaactgtgagaatggaggcaagtgcatagagaag
taccatggctattcctgcgattgctccaacacagcctatgatggaacattttgcaacaaa
gacgtgggtgcgttttttgaagaggggatgtggctgcggtataacttccaggcgccrggg
atcgggacccgggattccggcagcagatcggagaactctccagacccgcagaatggagcc
ccagacctggcgggcgaggagatccgcttcagcttcagcaccaccaaggcgccctgcatc
ctcctctacgtcagctccttcaccaccgacttcctggcggcgctcgtcaaacccaccgga
agcctccaggtccggtacaacctgggtggcacccgggagccctataacattgacgtggac
caccggagcatggctaacggccagccccacagcgttaacatcacccgtcgtgagaggacc
atcactctcaagctggatcactatccttccgtgagttaccacctgccaagttcatccgac
acgctcttcaattctcccaagtcgctcttcctaggaaaagtcatagaaacagggaagatc
gaccaagagatccacacgtacaacaccccgggattcaccggctgcctctccagagtccag
ttcaaccaaatcgcccctctcaaggcggccttgaggcagaccaacgcctcagctcacgtg
cacatccagggcgagctggtggaatccaactgcggggcctccccgctcaccctgtctccc
atgtcgtccgccaccgacccctggcacttggaccacctggattcggccagtgctgatttt
ccgtataacccaggacaaggccaggccataagaaatggagtcaacagaaactcggccatc
atyggaggggtcattgccgtggtcatcttcaccatcctctgcaccttggtcttcctcatt
cgctacatgttccgtcacaagggcacctaccacaccaacgaggcgaagggcgcggagtcc
gccgagagcgccgacgccgccatcatgaacaacgaccccaacttcacagagaccatcgac
gagagcaaaaaggaatggctcatctga

DBGET integrated database retrieval system