KEGG   Bos indicus (zebu cattle): 109558177Help
Entry
109558177         CDS       T04792                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00350  Tyrosine metabolism
biu00360  Phenylalanine metabolism
biu00380  Tryptophan metabolism
biu01100  Metabolic pathways
biu04726  Serotonergic synapse
biu04728  Dopaminergic synapse
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
Module
biu_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109558177 (DDC)
   00360 Phenylalanine metabolism
    109558177 (DDC)
   00380 Tryptophan metabolism
    109558177 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    109558177 (DDC)
   04726 Serotonergic synapse
    109558177 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    109558177 (DDC)
   05031 Amphetamine addiction
    109558177 (DDC)
   05034 Alcoholism
    109558177 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109558177 (DDC)
Enzymes [BR:biu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109558177 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     109558177 (DDC)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109558177 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 109558177
NCBI-ProteinID: XP_019815183
Position
4
AA seq 487 aa AA seqDB search
MNASEFRRRGKEMVDYVADYLEGIEGRQVFPDVDPGYLRPLIPTTAPQEPETFEAIIEDV
EKIIMPGVTHWHSPXFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLQLPEAFLAGEAGEGGGVIQGTASEATLVALLAARTKVTRXLQAASPELTQAAIM
EKLVAYASDQAHSSVEKAGLIGGVRLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVV
ATLGTTSCCSFDNLLEVGPICHKEGLWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPVYLRHSHQDSGLITDYRHWQLPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHAFEALVRQDTRFEICAEVILGLVCFRLKGSNKLN
EALLESINSAKKIHLVPCSLRDRFVLRFAICSRTVELAHVQLAWEHIQEMAATVLRAQGE
EKAEIKN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaagcgagttccgcaggcgggggaaggaaatggtggattacgtggctgactac
ttggagggcattgaagggcgccaggtgttccctgacgtggatccaggctacctgcgcccc
ctgatccccaccaccgccccgcaggagccagagacatttgaggccatcatcgaggacgtc
gagaagatcatcatgccgggggtgacccactggcacagtcccyacttcttcgcctacttc
cccacggccagttcgtacccggccatgctcgcggacatgctgtgtggggccatcggctgc
atcggcttctcctgggctgccagcccggcgtgcacagagctcgagacggtgatgatggac
tggctggggaagatgctgcagctgccagaggcgtttctggctggagaagctggagaaggc
ggcggggtgatccagggaactgccagtgaagctaccctkgtggccctgctggccgctcgg
accaaagtgacccgacrcctgcaggctgcctccccagagctgacgcaggctgccatcatg
gagaagttggtggcctacgcrtctgaccaggcacactcctccgtggaaaaagccggctta
attggcggagtgagattaaaagccatcccttccgatggcaagtttgccatgcgagcttcc
gcgctgcaggaggccctggagagagacaaggcagccggcctgattcctttcttcgtggtg
gctacactggggaccacgtcctgctgctcctttgacaacctcttagaagtggggcccatt
tgtcacaaggagggcttgtggctgcacgtggacgccgcctacgcaggcagtgccttcatc
tgccctgagttccggcatcttctgaatggcgtggagtttgcagattcatttaactttaat
ccccacaaatggctcttggtgaattttgactgctctgccatgtgggtgaaaaagaggaca
gacctgaccggagccttcaggctggacccagtctatctgaggcacagccaccaggactca
gggcttatcactgactacaggcactggcagctgccrctgggccggaggttccgctctttg
aagatgtggtttgtttttaggatgtacggagtcaagggactgcaggcctatatccgcaag
catgtccagctgtcccatgcattcgaggcattggtgcgccaggacacccgctttgaaatc
tgtgcagaagtcattctgggactggtctgtttccggctaaagggttccaacaaactgaac
gaagctcttctggaaagcataaacagtgccaaaaaaatccacttggtcccttgttccctg
agagaccggttcgtgctgcgcttcgccatctgctcacgcacagtggagctggcccaygta
cagctggcctgggagcacatccaggagatggcggccacagtgttaagagcacagggggag
gaaaaggcagagatcaaaaattga

DBGET integrated database retrieval system