KEGG   Bos indicus (zebu cattle): 109558321
Entry
109558321         CDS       T04792                                 

Definition
(RefSeq) complement C1r subcomponent-like
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109558321
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109558321
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109558321
  09171 Infectious disease: bacterial
   05133 Pertussis
    109558321
   05150 Staphylococcus aureus infection
    109558321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109558321
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109558321
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     109558321
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109558321
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109558321
SSDB
Motif
Pfam: CUB FXa_inhibition Sushi cEGF EGF_CA hEGF EGF EGF_3
Other DBs
NCBI-GeneID: 109558321
NCBI-ProteinID: XP_019815333
Position
5
AA seq 432 aa
MIFVITSCFWLTLALESEDKPSLHSATHQQRDLGLIIELLSFFKDEIERMWLLHLLLPVL
FYRVGGAIPTPQGFYGEVMSPLFPKPYPNNFERTTVITVPMGYRVKLVFWQFDLEPSEGC
LYDYVKISADKKTMGRFCGQLGSPLGNPPGRKEFMSQGNKMLLTFHSDFSNEENGTIMFY
KGFLAYYQAVDLDECALXLNSVEEDPPARCQHLCHNYVGGYFCSCRPGYELQPDGRSCQA
ECSSELFTEPSGYISSLEYPRPYPPDLRCNYSIRVERGHTLHLQFLEPFEIDDHQQIHCP
YDKLKIYVSGRNIGEFCGKQRPERIDTQSNSVDLLFFTDESGDSRGWKLCYTSEVITCPQ
PKTLDSCTIIQDLQPLYHFKDRFTATCKEGYQLMEGNKALLSFTAVCQDDGTWHRAMPRC
RSKLQLKHVSPP
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgatatttgtgatcacgtcttgcttctggctgacactggccctggaatcagaggacaag
ccaagtctccactctgccactcaccagcagagggaccttgggctcatcatcgaacttctt
agcttcttcaaggatgaaatagagagaatgtggctcttacacctcctgctgccggtcctg
ttctacagggtgggaggcgccatccccacccctcaggggttctacggggaggtgatgtcc
ccgttgttccccaagccttaccctaacaattttgagaggaccactgtgatcacagtaccc
atggggtacagggtgaagcttgtcttctggcagtttgacctggagccttcggaaggttgt
ctctatgactatgtcaagatttctgctgataagaagaccatggggaggttctgtgggcag
ctgggttctcccctgggcaaccccccaggaaggaaggaattcatgtcccaagggaacaag
atgctgctgaccttccactcggacttctccaacgaggagaacggcaccatcatgttctac
aagggcttcctggcatactaccaagccgtggacctggaygaatgtgccttgcwgctcaac
tcagtcgaggaggaccccccagcccggtgccagcacctgtgccacaactacgtcggtggc
tatttctgctcctgccgtccaggctatgagctccagccggatgggcgttcctgccaggcc
gaatgcagcagcgagctgttcacggagccctcaggctacatctccagcttggagtacccc
cggccctacccccctgacctgcgctgcaactayagtatccgagtagagcgaggccacacc
ctccacctccaattcctggagccttttgaaatcgatgaccaccagcaaatacactgtccc
tacgacaagttgaagatctatgtcagtgggaggaacattggtgagttctgtggaaagcaa
aggcctgagcgcattgatacccaaagcaactcagtggacctgctcttcttcacggacgag
tcaggggacagccggggctggaagctgtgctacaccagtgaagtcatcacgtgcccccag
cccaagaccctggactcatgcaccatcattcaggacctgcagcctctatatcatttcaag
gaccgtttcactgccacctgcaaagaaggctaccagctcatggaggggaacaaggcactc
ctgtccttcacagctgtctgccaggatgatggcacatggcaccgtgccatgcccaggtgc
aggagtaagttgcaactcaagcatgtgtctcccccatga

KEGG   Bos indicus (zebu cattle): 109558899
Entry
109558899         CDS       T04792                                 

Definition
(RefSeq) complement C1r subcomponent-like isoform X1
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109558899
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109558899
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109558899
  09171 Infectious disease: bacterial
   05133 Pertussis
    109558899
   05150 Staphylococcus aureus infection
    109558899
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109558899
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109558899
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     109558899
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109558899
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109558899
SSDB
Motif
Pfam: Trypsin Sushi Trypsin_2 DUF316
Other DBs
NCBI-GeneID: 109558899
NCBI-ProteinID: XP_019815792
Position
5
AA seq 416 aa
MMFHVGRVPSTACPPVPPPQISTDKKTLGTFCGQLSSPLGNPPGRMEFVSQGNRILLTFH
TDFSNXENGTDIFYKGFQAHYQAVVKDCGQPRSLPNGAFNYTTREGVSTYEARIQYCCHE
PFYKMHSNDGTSESERGLYTCMAQGIWKNELVGQKMPWCLPVCGEPIHPVKQRQRIIGSL
KAKLGNFPWQAYTNIHGPGGGALLGDRWILTATHTINPKDHKAQGSPNLDVFLGHVNVED
STNHPVRRVIIHPDYRQEESHSFEGDIALLELENSVTLSPNLLPICLPDNETLYDPGLIG
YVSGFGIMEERISHDLRFVRLPAARRETCEXWLRQKKKKKNRNDVFSENMFCAGSPTLKH
NVCRGDAGGVFAVRDKKNDRWVATGIVTWGIGCGEGYGFYTNVLKYVDWIKKEMEV
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgatgttccacgtgggacgtgtcccttcaacagcttgtcccccggtccctcctccacag
atctctactgataagaagaccctagggacgttctgtgggcagctgagctctcccctgggc
aacccccctggaaggatggaattcgtgtcccaaggaaacaggatactgctgaccttccac
acagacttctccaacraggagaatggcactgacatattctacaagggcttccaggcccac
taccaagccgtggtcaaggactgcgggcagccccgaagcctgcccaatggggccttcaat
tacaccaccagagagggggtgagcacgtacgaggcccgtatccagtactgctgccacgag
cccttctacaagatgcacagcaacgatggcacgagcgagtctgagcgagggctgtacacc
tgcatggctcagggcatttggaagaacgagctggtaggacagaagatgccttggtgtttg
ccagtgtgcggggagccaatccaccctgtcaaacagaggcagcgcatcattggaagcctg
aaggccaagctgggcaacttcccctggcaggcctacaccaacatccacgggcccgggggt
ggtgcgctgctgggggaccgctggatcctcacggccacgcacaccatcaaccccaaggac
cacaaggcgcagggcagccccaacttagacgtgttcctgggccacgtcaacgtggaagat
agcaccaaccacccggtccgtagggtcataatccacccagactaccgccaggaagagtcc
cacagtttcgagggggacatcgccctcctggagctggaaaatagcgtcaccctgagcccc
aacctcctgcccatctgcctcccagacaacgagaccctctatgacccgggtctgataggc
tatgtcagtggctttgggatcatggaggagagaatttctcaygacctcaggtttgtccgt
ctgccagcagctaggcgagagacttgcgagcrctggctccggcaaaaaaaaaaaaaaaaa
aacaggaatgatgtgttttctgaaaacatgttctgtgctgggagcccaaccttaaagcac
aatgtctgccgtggggatgccggaggggtctttgcagtgagggataagaaaaatgaccgc
tgggtggccacgggcatcgtgacctggggcatcgggtgtggtgaagggtacgggttctac
accaatgtcctcaagtacgtggactggatcaagaaagagatggaagtgtaa

KEGG   Bos indicus (zebu cattle): 109558901
Entry
109558901         CDS       T04792                                 

Gene name
C1R
Definition
(RefSeq) complement C1r subcomponent isoform X1
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04145  Phagosome
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109558901 (C1R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109558901 (C1R)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109558901 (C1R)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109558901 (C1R)
   05150 Staphylococcus aureus infection
    109558901 (C1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109558901 (C1R)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109558901 (C1R)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     109558901 (C1R)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109558901 (C1R)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109558901 (C1R)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA hEGF EGF Trypsin_2
Other DBs
NCBI-GeneID: 109558901
NCBI-ProteinID: XP_019815794
Position
5
AA seq 713 aa
MDREENAQRWLLYLLLPVLFYRVGGATPTPQKLYGEVMSPLFPKPYPNNFERTTVITVPT
GYKVKLVFWQFDLEPSEGCLYDYVKISADKKTMGRFCGQLGSPLSNPPGRKEFMSQGNKM
LLTFHSDFSNEENGTIMFYKGFLAYYQAVDVDECALQLNSVEEDPPAGCQHLCHNYVGGY
FCSCRPGYELQPDGRSCQAECSSELFTEPSGYISSLEYPRPYPPDLRCNYSIRVERGHTL
HLQFLEPFEIDDHQQIHCPYDQLQXYVSGRNIGEFCGKQXPERIDAQSNSVDLLFFTDES
GDSRGWKLYYTSEVIKCPQPKTLDSFTIIQDLQPQYQYRDYFIATCKKGYELVEGNKALL
SFTAVCQDDGTWHRAMPRCRIKDCGQPRSLLNGAFNYTTREGVNTYEARIQYYCHEPFYK
MHTKGXTSESERGLYTCTAQGIWKNELVGEKMPRCLPVCGKPVHPVEQRQRIIGGLKAKL
GNFPWQAYTNIHGPGGGALLGDRWILTAAHTINPKDHEAQGSPNIDVFLGHINVEDITKL
SNHPVRRVIIHPDYRQEESHNFEGDIALLELENSVTLGPNLLPICLPDNETLYDPGLMGY
VSGFGIMEERISHNLRFVRLPVAKREICERWLRQKNRNDVFSENMFCAGNPATRQDSCQG
DSGGVFAVSDKKNDRWVATGIVSWGIGCGEGYGFYTNVLKYVDWIKKVMEVED
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggaccgagaggaaaatgcccarcggtggctcttatacctcctgctgccagtcctgttc
tacagggtgggaggcgccacacccacccctcagaagctctatggggaggtgatgtccccg
ytgttccccaagccttaccctaacaattttgagaggaccactgtgatcacagtacccacg
gggtacaaggtgaagcttgtcttctggcagtttgacctggagccttcggaaggttgtctc
tatgactatgtcaagatttctgctgataagaagaccatggggaggttctgtgggcagctg
ggttctcccctgagcaatcccccaggaaggaaggaattcatgtcccaagggaacaagatg
ctgctgaccttccactcggacttctccaacgaggagaacggcaccatcatgttctacaag
ggcttcctggcatactaccaagccgtggacgtggacgaatgtgccttgcagctcaactca
gtcgaggaggaccccccggccgggtgccagcacctgtgccacaactacgtcggyggctat
ttctgctcctgccgtccaggctatgagctccagccggatgggcgttcctgccaggccgaa
tgcagcagcgagctgttcacggagccctcaggctacatctccagcttggagtacccccgg
ccctacccccctgacctgcgctgcaactacagtatccgagtagagcgaggccacaccctc
caccttcaattcctggagccttttgaaattgatgaccaccagcaaatacactgtccctac
gaccagctgcagrtctatgtcagcgggaggaacatcggtgagttctgtggaaagcaaarg
cccgagcgcattgatgcccaaagcaactcggtggacctgctcttcttcacggacgagtca
ggggacagccggggctggaagctgtactacaccagtgaagtcatcaagtgcccccagccc
aagaccctggactcattcaccatcattcaggacctgcagcctcaataccagtaccgggac
tatttcatcgccacctgcaaaaaaggctacgagctygtggaggggaacaaggcactcctg
tccttcacagctgtctgccaggatgatggcacatggcaccgtgccatgcccaggtgcagg
atcaaggactgygggcagccccgaagcctgctcaacggggccttcaattacaccaccaga
gagggggtgaacacctacgaggcgcgtatccagtactactgccaygagcccttctacaag
atgcacaccaaaggyrgcacaagcgagtctgagcgagggctgtacacctgcacggctcag
ggcatttggaagaacgagctggtaggagagaagatgcctcggtgtttgccagtgtgcggg
aagccagtccaccctgtcgagcagaggcagcgcatcattggaggcctgaaggccaagctg
ggcaacttcccctggcaggcctacaccaacatccacgggcccgggggtggcgcgctgctg
ggggaccgctggatcctcacggccgcgcacaccatcaaccccaaggaccacgaggcgcag
ggcagccccaacatagacgtgttcctgggccacatcaatgtggaagatatcaccaagctg
tccaaccacccggtccgtagggtcataatccacccagactaccgccaggaagagtcccac
aatttcgagggggacatcgccctcctggagctggaaaatagcgtcaccctgggccccaac
ctcctgcccatctgcctcccagacaacgagaccctctatgacccgggtctcatgggctat
gtcagtggctttgggatcatggaggagagaatttctcacaacctcagatttgtccgtctg
ccagtagctaagcgagagatttgtgagcgctggctccggcaaaaaaacaggaatgatgtg
ttttctgaaaacatgttctgtgctgggaacccagccacaaggcaagattcctgccaaggg
gatagtggaggggtctttgctgtaagtgataagaaaaatgaccgctgggtggccacgggc
atcgtgtcctggggcatcgggtgtggtgaagggtacgggttttacaccaatgtcctcaag
tatgtggactggatcaagaaagtgatggaagtggaagactga

KEGG   Bos indicus (zebu cattle): 109558903
Entry
109558903         CDS       T04792                                 

Gene name
C1S
Definition
(RefSeq) complement C1s subcomponent
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109558903 (C1S)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109558903 (C1S)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109558903 (C1S)
   05150 Staphylococcus aureus infection
    109558903 (C1S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109558903 (C1S)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109558903 (C1S)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     109558903 (C1S)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109558903 (C1S)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109558903 (C1S)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA Trypsin_2 CUB_2 EGF hEGF
Other DBs
NCBI-GeneID: 109558903
NCBI-ProteinID: XP_019815796
Position
5
AA seq 695 aa
MNKLPEMWCIVLFSLVAWVYAEPTMYGEILSPNYPQXYPNEVEKSWDIEVPAGYGIHLYF
THLDIELSENCSYDSVQIMSGGHEEGKLCGRRTNKNSNSPVVKEFHIPYSKLQVIFRSDF
SNEERFTGFAAYYVAEDIDECTAFADAPCSHFCNNFLGGYFCSCPPEYFLHEDKKNCGVN
CSGNVFTTMTGEVESPNYPSPYPESSRCDYQIQLEEGFRVVVTMRREDFDVEPADSEGHC
PDSLLFVAGDQHFGPYCGNGFPGPLTIETQSSALNIIFQTDGSEQRKGWKFRYHGDPIPC
PKEVTANSFWEPERAKYVFRDVVKITCVDGFEVVQGSVGSPSFYSTCQSNGKWSNSKLRC
QPVDCGAPEPIQHGRVEDPESTLFGSITRYSCEMPYYSMEYEGSEVYHCSGNGSWVNKVL
GIEPPKCIAVCGTPSEPFRSTQRIFGGSIAKIENFPWQVFFSNPWAGGALIDEYWVLTAA
HVVEGNDIPVMYVGSSSVVTSQLSNAQMLTAERVFIHPGWEVLDPSITRKNFDNDIALVR
LRDPVKMGPKVAPICLPGTSSEYDPPENVLGLISGWGRTNVKSHVIKLRGAKLPVAPLSK
CREMKGVNPGIDISSFVFTENMICAGNDKGVDSCDGDSGGAFAVQDPKENKPKFYVAGLV
SWGPQCGTYGIYTRVKNYVDWIRKTMQEYSAPSVD
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgaacaaattgccagagatgtggtgcattgtcctgttttcccttgtggcctgggtttat
gccgagcctactatgtatggagagattctatcccccaactaccctcaggygtaccccaac
gaggtcgagaagtcttgggacatagaagtccctgcagggtacgggatccacctttacttc
acccacctggatatagagttgtctgagaactgctcctatgattcagtgcagataatgtcg
ggaggccatgaagaagggaaactctgtggacggaggaccaacaagaattcaaactcccca
gtggtgaaagagttccacatcccatacagtaaattgcaggtgatcttccggtcggacttc
tccaacgaggagcgtttcaccgggtttgctgcgtactatgttgctgaggatatagatgag
tgcacagcctttgcagatgctccttgcagccacttctgcaataacttccttggtggttac
ttctgctcctgccctccagaatacttcctccatgaagacaagaagaactgtggagtcaat
tgcagtggaaatgtattcaccacaatgactggggaggttgaaagtcctaattaccccagt
ccatacccagagagctcaaggtgtgactatcagatccagttggaggaggggttccgagtg
gtggtgaccatgaggagagaagactttgatgtggaaccagctgactccgagggccactgt
cccgacagtttgctctttgtggcaggagaccagcattttggtccttactgtgggaacggc
tttcctgggccactaacaattgaaacccagagcagtgctctgaatatcatcttccaaact
gatggatcagaacaaagaaagggatggaaatttcgttaccatggagatccaatcccttgt
cctaaagaagtcactgccaattccttctgggagcctgagagagcaaaatatgtgttcaga
gatgtggtgaagataacctgtgtggatgggtttgaagttgtgcagggaagtgttggttcc
ccatctttctactctacttgtcaaagcaatggaaagtggagtaattccaagttgcggtgt
caacccgtggactgtggcgctcctgaacccattcagcatggtagagttgaagatccagaa
agtactctatttggttccatcactcgctactcttgtgagatgccatattacagcatggaa
tatgaagggagcgaggtgtatcactgcagtggcaatgggagctgggtgaacaaggtgctg
ggcatagagccgccgaaatgcattgcagtctgtggcacccccagcgagccttttagatca
acacaaagaatatttggaggctccattgcgaagattgaaaatttcccctggcaagtcttc
ttctcgaacccatgggctggtggggctctcattgatgaatactgggtgctgacagctgcc
catgtcgtggagggaaacgatatcccagtgatgtatgttgggtcctcctcagtggtcacc
tcacaattgtcaaatgctcagatgctcactgcagagagagtgtttatccatccaggatgg
gaggtcctggatccttcgataacacgaaagaattttgacaatgacattgcgctggtgcgg
ctgagagacccagtgaaaatgggacccaaggtcgcccctatctgcctaccaggcacctcc
tcagaatatgaccctccggagaacgtcctgggcctgatctcaggttggggtcgaacaaat
gtcaaaagtcatgttattaagctcagaggggcaaagctacccgttgctcccttatccaaa
tgccgggagatgaagggggtcaatcctggaatagatatcagttcttttgttttcactgag
aacatgatctgtgccggtaatgacaagggtgttgacagctgtgacggggacagtggtggg
gcctttgctgtacaggaccctaaggaaaacaagcccaaattctatgttgctggtttggtg
tcctggggcccccagtgtgggacctatgggatctacactcgagtcaagaactacgttgac
tggataaggaagacaatgcaggagtatagtgcccccagtgtagactaa

KEGG   Bos indicus (zebu cattle): 109574037
Entry
109574037         CDS       T04792                                 

Gene name
C1QB
Definition
(RefSeq) complement C1q subcomponent subunit B
  KO
K03987  complement C1q subcomponent subunit B
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05133  Pertussis
biu05142  Chagas disease
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109574037 (C1QB)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109574037 (C1QB)
  09164 Neurodegenerative disease
   05020 Prion disease
    109574037 (C1QB)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109574037 (C1QB)
   05150 Staphylococcus aureus infection
    109574037 (C1QB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109574037 (C1QB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109574037 (C1QB)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109574037 (C1QB)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 109574037
NCBI-ProteinID: XP_019837302
Position
2
AA seq 247 aa
MKTPWGSVLVLLLLNLLRVSWAQSNCIRPSIPGIPGIPGKPGSDGKPGTPGTKGEKGLPG
LVSHLNENGEKGDPGFPGMPGKVGPKGPIGPKGVPGPPGVRGPKGESGDYKATQKIAFSA
SRTINHHQRQGQPIRFDHVITNANENYQARSSKFTCKVPGLYFFTYHASSRGQLCVDLMR
GRAEPQKVVTFCDYVQNTFQVTTGSIVLKLEKDETVFLQATEKNALVGIEGANSIFSGFM
LFPDTEA
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaagaccccttggggcagcgtgttggtgctgctgctcctgaatctgctccgtgtctcc
tgggcccagagcaactgcatcaggccgtccatccctggcatcccgggcattcccgggaaa
ccaggctccgatggcaagcctgggactccagggacaaagggagagaaagggcttccaggg
ctcgttagccacctcaacgagaatggcgagaagggggacccagggtttcctgggatgcct
ggaaaagtcggccccaagggccccattgggcccaagggtgtcccagggcctcccggagtc
cgaggccccaagggtgaatcgggagactacaaggccacgcagaaaatcgccttctcagcc
tcacgcaccatcaaccaccaccagagacagggccagcccatccgcttcgaccacgtgatc
accaacgccaatgaaaactaccaggctcggagcagcaagttcacgtgcaaggtgcccggg
ctctacttcttcacctaccatgccagctcccgagggcagctgtgcgtggacctcatgcgg
ggccgggcggagccccagaaggtggtcaccttctgcgactacgtccagaacaccttccag
gtcaccacaggcagcatcgtgctcaagctagagaaggatgagaccgtcttcctgcaggcc
accgaaaagaatgctctggtgggcatcgaaggcgccaacagtatcttctccgggttcatg
ctcttccctgacacagaagcgtga

KEGG   Bos indicus (zebu cattle): 109574050
Entry
109574050         CDS       T04792                                 

Gene name
C1QC
Definition
(RefSeq) complement C1q subcomponent subunit C
  KO
K03988  complement C1q subcomponent subunit C
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05133  Pertussis
biu05142  Chagas disease
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109574050 (C1QC)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109574050 (C1QC)
  09164 Neurodegenerative disease
   05020 Prion disease
    109574050 (C1QC)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109574050 (C1QC)
   05150 Staphylococcus aureus infection
    109574050 (C1QC)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109574050 (C1QC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109574050 (C1QC)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109574050 (C1QC)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 109574050
NCBI-ProteinID: XP_019837328
Position
2
AA seq 243 aa
MGSGAWPLLVLNLLLLLLARPLRGQTETYCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGI
PAAPXTRGPKGQKGDPGTPGYPGKNGPMGTPGIPGAPGTMGPPGEPGVEGRYKQKHQSVF
SVTRQTVQFPEANSLVKFNRVITNPQGHYDKDSGKFTCKVPGLYYFVFHTSHTSNLCVLL
YRSGFKVATFCDHMTSAKQVSSGGVLLRLQEGQQVWLAVNDYNGMVGXEGSDSVFSGFLL
FPD
NT seq 732 nt   +upstreamnt  +downstreamnt
atggggtccggtgcctggcccctcctggtactaaacctgctgctgctcctgctggcacgg
ccactcaggggccagacggaaacatactgctatgggatcccygggatgccgggcctgccc
ggggcccccgggaaggatgggtatgayggactgccagggcccaagggtgaaccaggaatc
ccagctgcccctnggacccgaggacccaagggccagaagggagaccccggcacacctggc
tatcctgggaagaacggtcccatggggaccccggggattccgggggctcccggcaccatg
ggcccccccggggagccgggtgtggagggcaggtacaagcagaaacaccagtcagtgttc
tcagtcacacggcagactgtccagttcccggaggccaacagcctggtcaagttcaaccgg
gtcatcaccaacccgcaggggcattatgacaaggactctggcaaattcacctgcaaagtc
cctggcctctactactttgtcttccacacgtcgcacacgtccaacctgtgcgtgctgctg
taccgcagyggcttcaaggtggccaccttctgcgaccacatgaccagygccaagcaggtc
agctcgggcggcgtactgctgcggctgcaggaaggccagcaggtgtggctggcggtcaac
gactacaacggcatggtgggcayggaaggctctgacagcgttttctccggcttcctgctc
ttccctgactag

KEGG   Bos indicus (zebu cattle): 109574058
Entry
109574058         CDS       T04792                                 

Gene name
C1QA
Definition
(RefSeq) complement C1q subcomponent subunit A
  KO
K03986  complement C1q subcomponent subunit A
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05020  Prion disease
biu05133  Pertussis
biu05142  Chagas disease
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109574058 (C1QA)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109574058 (C1QA)
  09164 Neurodegenerative disease
   05020 Prion disease
    109574058 (C1QA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109574058 (C1QA)
   05150 Staphylococcus aureus infection
    109574058 (C1QA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109574058 (C1QA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109574058 (C1QA)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109574058 (C1QA)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 109574058
NCBI-ProteinID: XP_019837341
Position
2
AA seq 244 aa
MEAPXGWLVISVLAISLASSVTEDVCRAPDGTHGSAGIPGRPGRPGLKGERGEPGAPAIQ
TGIRGLKGDQGDPGPPGNPGRMGYPGPSGPMGPAGLPGLKGTKGSPGNIKDQPRPAFSAV
GPNSVSRDNVVVFGKVITNQENVYQNNTGRFRCSVPGYYYFTFQVVSNWDICLSIRSSRR
DQIQPLGFCDFNSKGFFQVVSGGTVLHLQQGDQVWIEKDPSKGRIYHGSEADSIFSGFLI
FPSA
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaagcccccwggggctggttggtgatcagcgtgctggccatttccctggcctcctcc
gtgactgaggacgtgtgccgagccccggacgggactcacgggagcgcaggaatacctggc
cgacccggacggccaggcctcaagggggagcgaggggagccgggggcgcctgccatccag
acaggcatccgmggccttaaaggagaccagggcgaccctggaccccctggaaacccaggc
agaatgggctacccaggaccctctggtcccatggggcccgctggcctcccaggattgaaa
ggcaccaaaggcagccccgggaacatcaaggaccagccacggccagccttctcggccgtt
ggaccgaattctgtctcaagagacaacgtggtcgtcttcggaaaggtcatcaccaaccag
gagaacgtgtaccagaacaacacaggcaggttccgctgctctgtcccaggctactactat
ttcaccttccaggtggtgtccaactgggacatctgcctgtccatcaggtcctctcggagg
gaccagatccagcccttgggcttctgtgacttcaacagcaagggattctttcaggtggtg
tctgggggcacagtgctgcatctccagcagggagaccaggtctggattgaaaaagatccc
agtaagggccgcatttaccacggctcagaggccgatagcatcttcagtggcttcctcatc
ttcccatctgcttga

DBGET integrated database retrieval system