KEGG   Bos indicus (zebu cattle): 109558547
Entry
109558547         CDS       T04792                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04114  Oocyte meiosis
biu04210  Apoptosis
biu04218  Cellular senescence
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04728  Dopaminergic synapse
biu04730  Long-term depression
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109558547 (ITPR2)
   04020 Calcium signaling pathway
    109558547 (ITPR2)
   04070 Phosphatidylinositol signaling system
    109558547 (ITPR2)
   04022 cGMP-PKG signaling pathway
    109558547 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109558547 (ITPR2)
   04210 Apoptosis
    109558547 (ITPR2)
   04218 Cellular senescence
    109558547 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109558547 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109558547 (ITPR2)
   04621 NOD-like receptor signaling pathway
    109558547 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    109558547 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109558547 (ITPR2)
   04929 GnRH secretion
    109558547 (ITPR2)
   04912 GnRH signaling pathway
    109558547 (ITPR2)
   04915 Estrogen signaling pathway
    109558547 (ITPR2)
   04921 Oxytocin signaling pathway
    109558547 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    109558547 (ITPR2)
   04918 Thyroid hormone synthesis
    109558547 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    109558547 (ITPR2)
   04924 Renin secretion
    109558547 (ITPR2)
   04925 Aldosterone synthesis and secretion
    109558547 (ITPR2)
   04927 Cortisol synthesis and secretion
    109558547 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109558547 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    109558547 (ITPR2)
   04971 Gastric acid secretion
    109558547 (ITPR2)
   04972 Pancreatic secretion
    109558547 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    109558547 (ITPR2)
   04725 Cholinergic synapse
    109558547 (ITPR2)
   04728 Dopaminergic synapse
    109558547 (ITPR2)
   04726 Serotonergic synapse
    109558547 (ITPR2)
   04720 Long-term potentiation
    109558547 (ITPR2)
   04730 Long-term depression
    109558547 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    109558547 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109558547 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109558547 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109558547 (ITPR2)
   05012 Parkinson disease
    109558547 (ITPR2)
   05017 Spinocerebellar ataxia
    109558547 (ITPR2)
   05020 Prion disease
    109558547 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109558547 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109558547 (ITPR2)
   05163 Human cytomegalovirus infection
    109558547 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109558547 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:biu04040]
    109558547 (ITPR2)
Ion channels [BR:biu04040]
 Ligand-gated channels
  IP3 receptor
   109558547 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec MIR RYDR_ITPR RIH_assoc Ion_trans DUF2207
Other DBs
NCBI-GeneID: 109558547
NCBI-ProteinID: XP_019815474
Position
5
AA seq 2059 aa
MSDKMSSFLYIGDIVSLYAEGSVNGFINTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGDLPASKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQDVLDVLITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKLVSMQGDNPMESAILSDDIDEEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCMSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYVWEHFSMTLNSVVHLARNLIYFGF
YSFSELLRLTRTLLAILDIVQAPMSSYFERLSKFQDGGKNFGEHRVTLVKLRGKCLNLSF
SAKNRGIAIPVDLDSQVNTLFLKSHSNMVQRAAMGWRLSARSGPRFKEALGGPSWDYRNI
IEKLQDVVASLEQQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKK
LMEKEEKLCIKILQTLREMLEKKDSFVEEGNTLRKILLNRYFKGDYGVSINGHLSGTYCK
TAQGGGSFSGQDSDKMGISMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALL
EGGNTQTQYSFYQQLHEQKKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDTE
LMTSGPRMRVRDSSLHLKEGMKGQLTEASSATSKAYCVYRREMDPEIDIMCAGPEAGNAE
DRSTEEVTMSPAIAIMQPILRFLQLLCENHNRELQHFLRNQNNKTNYNLVCETLQFLDCI
CGSTTGGLGLLGLYINEKNVVLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALI
LNDINPLGKYRMDLVLQLKNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYN
QGLECDHGDDEGGDDDVSPKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDDGDEALKYY
ANHTAQIEIVRHDRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTED
LYNEMKWQKKIRSNPALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPX
FSILLWIAVAICTSMLFFFSKPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVF
LVSFVGNRGTFTRGYRAVILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLL
NVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPITGSNAVPT
MTLTSILSTCEKDNCSPTIPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGD
VLRRPSKDEPLFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTC
FICGLERDKFDNKTVSFEEHIKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVEKN
LDWFPRMRAMSLVSSEGDSEQNEVRNLQEKLESTMSLVKQLSSQLAELKEQMTEQRKNKQ
RLGFLGSNTPHVNHHMPPH
NT seq 6180 nt   +upstreamnt  +downstreamnt
atgtccgataaaatgtccagcttcctctatataggggacatcgtgtccctgtacgcggag
ggttcggtcaacggtttcatcaacacgctgggactggtggatgaccgatgtgtggtgcac
ccagaagcaggggaccttgccaaccctcccaagaagttccgagactgcctctttaaggtg
tgccctatgaaccgatattctgctcagaagcaatattggaaagccaagcaagctaaacaa
gggaaccacacagaggcggccttgctgaagaaattacagcatgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaagctattgggagaaattgtgaaatacagtaatgtt
atacaactactgcatataaaaagcaacaagtatctgactgtcaacaagagattacctgct
ttactggagaagaatgccatgcgcgtgtccttggatgctgcgggaaatgaagggtcttgg
ttttatattcatcccttctggaagctgagaagcgagggcgacaatattgttgttggagat
aaagttgttttgatgcccgtgaatgcaggacagccactacatgccagcaacattgaacta
ctcgataatccagggtgtaaagaggtgaatgctgttaattgcaacactagctggaaaatc
actttattcatgaaatacagttcctatcgagaagatgtactaaaaggaggtgatgttgtt
cgcttgttccatgcggaacaagagaagtttctgacttgtgatgaatatgagaaaaagcag
cacattttccttcgtacaaccttgcgtcaatcagcyacttctgcaaccagctctaaagca
ctctgggaaatagaggtagttcatcatgatccatgccgtgggggtgcaggacagtggaac
agcttgttcagatttaaacatcttgcaactgggaactatttagctgcagagcttaaccct
gattatcgagatgcccaaaatgaaggaaaaaatgtgagagatggggatcttccagcttca
aagaagaaacgccaggcaggggagaagatcatgtacactttggtctcagtcccgcatgga
aatgacattgcgtcgcttttcgaactggatgccacgactcttcagagagcagactgcctg
gttccaaggaactcatatgtgcggttaagacatctatgtacaaacacatgggtaaccagt
actagcatccccatagacacrgatgaagagaggcctgttatgttgaagattggaacttgc
cagacaaaagaagataaagaagcatttgccattgtgtctgtcccactgtccgaggtccga
gatttagactttgccaatgatgcaaataaagtgctggcgactacagttaaaaagctggaa
aatggcacaataacccagaatgaaaggaggtttgtaaccaagttactggaagaccttatc
ttctttgttgctgatgtacctaacaacggacaagacgttctagacgtgcttatcaccaag
ccaaaccgagaacgtcagaagttaatgagggaacagaacatattggcacaggtatttggg
attcttaaagcaccctttaaggagaaagcaggagaaggctcaatgttgagactkgaagat
ctgggggatcaaagataygccccctataagtacatgctgaggctgtgctaccgtgtgctg
agacattcgcagcaggactaccggaaaaatcaggaatacattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagataccatcacagctttgttgcac
aacaacagaaaactactagagaaacacattacagcaaaagaaatagaaacatttgttagt
ttactcaggagaaatcgagagccaaggtttttggattatttatcagatctgtgtgtgtct
aataccaccgcgataccygtaactcaagaactcatctgcaaatttatgttgagcccgggc
aatgcagacattctcattcaaaccaaactggtctcaatgcaaggagacaaccccatggag
agtgccatcctttcagatgacattgatgaggaagaagtttggctctactggattgacagc
aacaaggaacctcatggcaaagccatcaggcaccttgcccaggaggcaaaggagggcacc
aaggctgatttggaagtccttacctattacaggtaccagctaaatctctttgcaagaatg
tgcttggatcgccagtatctggccataaaccagatttctacacagctctctgttgatttg
atcctgcgatgtatgtcagatgagagcctgccttttgacctccgagcatccttttgtcgc
ctcatgctccacatgcatgttgaccgggatccccaggagtccgtagtgcctgttcgctat
gcccggctctggacagaaatccccacgaagatcacaattcatgagtatgtttgggagcat
ttctcgatgactttaaattcagtggttcacttggctcggaatcttatatactttggattt
tacagtttcagtgaattgttacggctaacaaggactcttctggctatcttagatattgtc
caggcccccatgtcatcgtattttgaaagattaagcaaatttcaagatggaggtaagaac
tttggagaacatcgagtaactttagtcaaattaagaggaaagtgtttaaatctttctttt
tcagcaaagaatcgtggaattgccattccagtggatttggacagccaagtgaatactctt
ttcttgaagagtcattcaaatatggtgcagagagcggccatgggctggagactatcagct
cgctctggaccacgatttaaggaagctcttggagggccttcttgggattacagaaatatt
attgaaaagttacaggatgtagtggcctccttggagcaacaattcagcccgatgatgcag
gctgaattctcagtgttggttgatgtgttgtacagcccagaactgctgtttcccgaggga
agcgatgcgagaataagatgtggcgctttcatgtcgaagttgattaatcatacaaagaaa
ctgatggaaaaagaagaaaaattgtgcattaaaattcttcagactttacgagaaatgcta
gagaagaaagacagctttgtggaagagggtaatacattaagaaaaatcctcctgaatcga
tactttaaaggtgattacggagtctctataaatggacacctctctggaacytactgcaaa
actgcacaaggaggaggaagcttttctgggcaagattcagataagatggggatatccatg
tcagatattcagtgtctcctggataaagaaggtgcatctgaacttgtcatcgatgttata
gtgaataccaaaaatgacagaattttttcagaaggcatcttacttggcattgccttgctg
gaaggaggaaacacacaaactcagtattccttctaccagcagttacatgaacaaaaaaaa
tcagaaaaattcttcaaagttctctacgaccgaatgaaggctgctcagaaagagataaga
tcaacagtgacagttaacaccatcgacttaggtaacaagaaaagggatgatgacacagaa
ctgatgacatctggcccacggatgagagtaagggattcatcattacatttaaaagaggga
atgaaagggcagttaacagaagcttcttcggccacatccaaagcatactgtgtatacaga
agagaaatggatccagaaatagacatcatgtgtgcaggacctgaagcrggaaatgccgag
gacaggtccaccgaggaagtcacaatgagccctgccattgccatcatgcagccgattttg
aggtttctgcagttactctgtgagaatcataaccgggagctgcagcacttcctgaggaat
caaaacaacaaaaccaattacaaccttgtctgtgagacccttcagtttttggattgcatt
tgtggaagtacaacaggaggcctgggactcttgggtctctacatcaacgagaagaatgta
gtgctggtcaaccagactctggagagcttgactgagtattgccaaggtccatgccatgaa
aatcagacatgtattgctactcatgaatctaatggaattgatatcatcattgctttgatt
ctaaatgacataaaccctcttggtaaatatcgaatggacctggtgctccaactaaagaac
aatgcctccaagcttttgctggccatcatggaaagcagacatgacagcgagaatgcagaa
aggattcttttcaacatgagacccagagaactggtggatgtgatgaagaatgcctataat
caaggattggaatgcgatcatggggatgatgagggcggagatgatgatgtttccccaaag
gatgttggacacaatatctatatcctggcccatcagttggcccgccacaacaaactttta
cagcagatgctcaaaccaggatccgatccagatgatggcgatgaagccttgaagtattat
gccaaccatactgcacagatcgagattgttcgacatgacaggacaatggaacaaatagta
tttcctgtccccaacatatgtgaatacctcacgcgagaatccaagtgtcgcgtattcaac
accacggagagggatgaacagggaagtaaagtgaatgactttttccagcaaactgaagat
ctctacaatgagatgaagtggcagaagaaaatcaggagtaatcctgccctgttctggttc
tcaaggcatatttctctttgggggagcatctcsttcaacctggctgtgttcatcaactta
gctgtggctctcttctacccatttggggacgatggagatgaaggtactctttcaccgayg
ttctcaattctgctttggatagcagtggcaatctgcacatctatgctgtttttcttctcc
aagcctgtgggtattcggccatttcttgtgtcagtaatgctcagatcaatatatacaata
ggtcttgggcctacattaatacttcttggtgcagcaaatctttgtaataaaatagtgttt
ctggtgagttttgttggaaatcggggtacgttcacccgaggctaccgagcggtcatcctg
gatatggcctttctctaccacgtggcgtatgtcctggtttgcatgctgggcctctttgtc
catgaattcttctatagcttcctgctttttgatttggtatatagagaagagaccctgctc
aatgtcataaaaagtgtcacacggaacggccgatccattattctaactgcagttcttgcc
ctcatccttgtctacctgttttccattattgggttcctttttctgaaggatgacttcact
atggaggtggataggctgaaaaacagaactcccatcacaggtagcaatgcagttcctacg
atgactttaacttcaatcctgagtacgtgcgaaaaggacaactgctcacctacaatacca
gcttcaaatacagctgatgaggaatatgaagatgggattgaaaggacatgtgacactctt
ctaatgtgcattgtgaccgtcctgaaccagggcctcaggaatggtggaggcgtgggcgac
gtgctgagaagaccatcaaaagatgagcccttgtttgctgctcgtgtggtttatgacctt
cttttttatttcattgtcatcattatcgttctgaacttgatttttggggttatcattgat
acttttgctgatctcagaagtgaaaaacagaaaaaagaagaaattctaaagaccacctgc
ttcatctgtggactcgagagggacaagtttgataataaaacggtttcttttgaggaacac
atcaagtcagaacacaatatgtggcattatttgtacttcctagtcctggtgaaggtgaaa
gacccaactgaatataccggacctgaaagttacgtggctcaaatgattgtggagaagaat
ttggactggtttcctcggatgcgagccatgtcccttgttagcagtgaaggtgacagcgag
caaaatgaggttcggaacctgcaggagaagctggagtcaaccatgagtctggtcaaacag
ctgtccagtcagctggcagagctcaaggagcagatgacagaacaaaggaagaataagcag
agactgggctttctcggatcaaacacaccccatgtgaatcatcacatgccaccacactga

KEGG   Bos indicus (zebu cattle): 109576135
Entry
109576135         CDS       T04792                                 

Gene name
ITPR1
Definition
(RefSeq) LOW QUALITY PROTEIN: inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04114  Oocyte meiosis
biu04140  Autophagy - animal
biu04210  Apoptosis
biu04218  Cellular senescence
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04713  Circadian entrainment
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04728  Dopaminergic synapse
biu04730  Long-term depression
biu04750  Inflammatory mediator regulation of TRP channels
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109576135 (ITPR1)
   04020 Calcium signaling pathway
    109576135 (ITPR1)
   04070 Phosphatidylinositol signaling system
    109576135 (ITPR1)
   04022 cGMP-PKG signaling pathway
    109576135 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109576135 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109576135 (ITPR1)
   04210 Apoptosis
    109576135 (ITPR1)
   04218 Cellular senescence
    109576135 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109576135 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109576135 (ITPR1)
   04621 NOD-like receptor signaling pathway
    109576135 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    109576135 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    109576135 (ITPR1)
   04929 GnRH secretion
    109576135 (ITPR1)
   04912 GnRH signaling pathway
    109576135 (ITPR1)
   04915 Estrogen signaling pathway
    109576135 (ITPR1)
   04921 Oxytocin signaling pathway
    109576135 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    109576135 (ITPR1)
   04918 Thyroid hormone synthesis
    109576135 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    109576135 (ITPR1)
   04924 Renin secretion
    109576135 (ITPR1)
   04925 Aldosterone synthesis and secretion
    109576135 (ITPR1)
   04927 Cortisol synthesis and secretion
    109576135 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109576135 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    109576135 (ITPR1)
   04971 Gastric acid secretion
    109576135 (ITPR1)
   04972 Pancreatic secretion
    109576135 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    109576135 (ITPR1)
   04725 Cholinergic synapse
    109576135 (ITPR1)
   04728 Dopaminergic synapse
    109576135 (ITPR1)
   04726 Serotonergic synapse
    109576135 (ITPR1)
   04720 Long-term potentiation
    109576135 (ITPR1)
   04730 Long-term depression
    109576135 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    109576135 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109576135 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109576135 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109576135 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109576135 (ITPR1)
   05012 Parkinson disease
    109576135 (ITPR1)
   05016 Huntington disease
    109576135 (ITPR1)
   05017 Spinocerebellar ataxia
    109576135 (ITPR1)
   05020 Prion disease
    109576135 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576135 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109576135 (ITPR1)
   05163 Human cytomegalovirus infection
    109576135 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109576135 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109576135 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:biu04040]
    109576135 (ITPR1)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109576135 (ITPR1)
Ion channels [BR:biu04040]
 Ligand-gated channels
  IP3 receptor
   109576135 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 109576135
NCBI-ProteinID: XP_019840112
Position
22
AA seq 2710 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEVRSKSVRELAQDAK
EGQKEDRDVLGYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPISKMAKGEENKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPTATAPEGNVKQAEP
EKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEG
PSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGAL
QLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPD
EAMDGASGENEHKKTEEGNNKSQQHESTSSYNYRVVKEILIRLSKLCVQESASVRKSRKQ
QQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHIN
LFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEG
KFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVEL
LAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEI
YTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTT
LQTRQPVFVQLLQGVXRVYHCNWLMPARSSVESXXXXXVLSDVAKSRAIAIPVDLDSQVN
NLFLKSHNLVQKTAMNWRLTARNAARRDSVLAXSRDYRNIIERLQDIVSALEDRLRPLVQ
AELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLR
EMMTKDRGYGEKGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGS
GSSPMSRGEMSLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQ
HSFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKK
AKEPATQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQSGEGAQAAADKNKDDLEMS
AVITIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGL
LGLYINEKNVALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKK
RMDLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGE
NGEDGAASPRNVGHNIYILAHQLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVR
LDRTMEQIVFPVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKL
RAQPVLYWCARNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLIS
LAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFT
RGYRAMVLDVEFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRS
IILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETSLPEASESLASEFLYSDVCRVE
TGENCSSPAPKEELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEE
PLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDK
FDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRA
MSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPP
HMNVNPQQPA
NT seq 8133 nt   +upstreamnt  +downstreamnt
atgtctgacaagatgtctagtttcctrcacatcggagacatttgttctctgtacgccgaa
ggatcgacaaatggatttattagcaccttgggcctggttgatgaccgttgtgttgtgcag
ccagaaaccggggaccttaacaatccacccaagaaattcagagattgcctctttaaacta
tgtcccatgaatcgctactctgcccagaagcagttctggaaagctgctaagccaggagcc
aacagcacgacagaygcagtgctgctcaacaaattgcaccatgctgcagacttggaaaag
aagcagaatgagactgaaaacaggaagttgctgggtaccgtgatccagtatggcaacgtg
atccagctactgcatctgaaaagtaataaatacctaactgtgaataagaggcttccggct
ctgctggagaagaatgccatgagagtgacattggatgaggccggaaacgaagggtcctgg
ttttacattcagccattctacaagctgcgatccatcggagacagtgtggtcataggtgac
aaggttgttctgaaccccgtgaatgccggccagcccttacatgccagcagccatcagctg
gtggataacccaggctgcaacgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgacaacaaagatgacatattaaaggggggtgacgtggtg
aggctgttccatgccgagcaggagaagtttctcacctgtgacgagcacaggaagaagcag
cacgtctttctgagaaccaccggccggcagtctgccacgtccgccaccagctcaaaagcc
ctgtgggaggtggaggtggtccaacatgacccatgtcggggaggagcagggtactggaac
agcctcttccgtttcaagcatcttgctaccgggcattacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggaccctgatcaggatgcctcc
cgaagcaggttgcgaaatgcccaagagaagatggtgtactccctggtctctgtgcccgag
ggcaatgacatctcctccatttttgagctggaccccacgacrctccgtggaggcgacagc
ctcgtcccgagaaactcctatgtccggctccgacacctgtgtacraatacctgggttcac
agcacaaacatycccattgacaaggaagaagaaaaacccgtgatgctgaaaattggcact
tctcccgtgaaggaggacaaggaagcctttgccatagtgccagtctctcctgctgaggtt
cgggatctggactttgccaatgaygccagcaaggtgctgggctccatagcgggcaagttg
gagaagggcaccatcacccagaatgaaagaagatctgtaaccaagctgctggaagacttg
gtttactttgtcactggcggaaccaattctggtcaagatgttcttgaagtggtcttctcy
aagcccaacagagagcgtcagaagctcatgagagaacagaatattctcaagcagatcttc
aagctattacaggccccattcacagactgtggtgacggcccaatgctgcgtctggaggag
ctgggagaccagcggcacgcacccttccgacacatctgccgcctttgctaccgggtcctg
agacattcccagcaggactacaggaagaaccaggagtacatagccaagcagttcggcttc
atgcagaagcagattggctatgacgtgctggccgaagacactatcaccgcccttctgcac
aataatcgcaaactcctggaaaaacacatcaccgcggcagagattgacaccttcgtcagc
ctggtgcggaagaacagggagcccagattcttagattacctctctgacctctgcgtgtcc
atgaacaaatccattccggtgactcaggaactgatatgtaaagccgtgctgaatccaacc
aatgccgacatcctcattgagaccaagttggtgctctcccgttttgaatttgaaggcgtt
tctaccggagagaacgctctggaggcaggcgaggatgaggaagaagtatggctcttctgg
agggacagcaacaaggaggttcgcagtaagagtgtccgggagctggcgcaggatgccaag
gagggccagaaggaagaccgcgacgtccttggctactacaggtaccagctgaacctcttt
gcgaggatgtgcctggaccgccagtaccttgccatcaacgagatctcgggccaactggac
gtggatctcattctccgctgcatgtccgacgagaacctgccctacgacctgcgggcatcc
ttctgccgtctcatgctccacatgcacgtggaccgagacccccaggagcaggtcaccccc
gtgaaatacgcccgcctctggtctgagatcccctccgagatcgccattgatgactacgat
agtagtggaacctccaaagatgaaattaaggagaggttcgctcagaccatggaatttgtg
gaggaatatttaagagatgtggtgtgtcagaggttccctttctctgataaggagaaaaat
aagcttacatttgaggttgtcaacctagctaggaatctcatctactttggtttctacaac
ttytccgaccttctccgattaaccaaaatcctcctggccatattggactgtgtgcacgtg
accacaatcttccccatcagcaagatggcgaagggagaggagaataaaggcagtaacgtg
atgcggtccatccatggggtcggagagctgatgacccaggtggtgctccggggaggaggc
ttcctgcccatgacacccacggccaccgcccctgagggcaacgtgaagcaggccgagccg
gagaaggaggacatcatggtgatggacaccaagctgaagatcattgaaatactccagttt
attttgaatgtgaggttggattataggatctcctgcctcctgtgtatatttaagcgggag
tttgatgaaagcaattcccagacttcagaaacatcctccggaaacagcagccaagaagga
ccaagtaatgtgccaggtgctcttgacttygaacacattgaagaacaagctgagggcatc
ttcggaggaagtgaggagaacaccccgctggacctggatgaccacggcggcagaactttc
ctccgagtcctgctccacttgacgatgcacgactacccacccctggtgtcgggggccctg
cagctcctctttcggcacttcagtcagagacaggaggtcctccaggccttcaaacaggtt
cagctgctcgttaccagccaagatgtcgataactacaagcagataaaacaagacctggac
cagctgagatccatcgtggagaagtcagagctctgggtgtacaaagggcagggccccgac
gaggccatggacggcgcatctggagaaaacgagcataagaagacagaggaggggaataac
aagtcacagcagcatgagagcaccagcagctacaactacagggtggtcaaagagattttg
atccgactcagcaaactctgtgttcaagagagcgcatccgtgcggaagagcaggaagcag
caacagcgcttgctccggaacatgggcgcccacgccgtggtgctggagctgctgcagatc
ccctacgagaaggctgaagacaccaagatgcaggagataatgaggctggctcatgagttt
cttcagaatttctgcgccggcaaccagcagaatcaggctctgctccacaaacatataaac
ctgtttctaaacccagggatcctggaagccgtcacgatgcagcacatcttcatgaacaac
ttccaactgtgcagcgagatcaacgagcgggtcgtccagcactttgttcactgcatcgag
actcacggtcgaaatgtccagtacatcaagttcctgcagacgattgtcaaggctgaaggg
aaattcatcaagaagtgccaagacatggtcatggccgagctggttaattcaggagaggat
gtcctcgtgttctacaacgacagagcctctttccagaccctgattcagatgatgaggtcc
gagcgggaccggatggacgagaacagccccctcatgtaccacatccatctggtggagctc
ttggccgtgtgcacrgagggcaagaacgtctacacggagatcaaatgcaactccctgctc
ccrctggatgacattgtccgcgtggtgacccacgaggactgcatcccygaggttaaaatt
gcctacattaacttcctgaatcactgctatgtggayacggaagtggaaatgaaggagatt
tataccagcaatcacatgtggaaattgtttgagaatttcctcgtcgacatctgcagggcc
tgtaayaacacgagcgacaggaaacacgcagactcgattctggagaagtacgtcaccgaa
atcgtcatgagcatcgtcaccacgttcttcagttctcccttctcagaccagagtacaact
ctgcagactcgccagcccgtctttgtgcagcttctgcaaggtgtgntycgggtttaccac
tgcaactggctcatgccagccagaagctcggtggagagtttnnnnnnnnnnnnggtgctc
tctgatgtagccaagagccgggccattgccattcccgtggacttggacagtcaggtcaac
aacctcttcctcaagtcccacaacctcgtgcagaaaaccgccatgaactggcggctgacg
gcccgcaatgctgcccgcagagactctgtcctggccrcttccagggactaccggaacatc
atcgagagactgcaggacatcgtctcggccctggaggaccgtctccggcccctggtgcag
gccgagttatctgtgctggtggatgtcctccaccggcccgagctgctcttcccggagaac
acggacgccaggaggaagtgtgaaagcgggggcttcatctgcaagttaatcaaacacact
aaacagctgctggaggagaatgaggagaaactctgcatcaaggtccttcagaccctcaga
gaaatgatgaccaaagacagaggctatggagaaaagggtgaggccctcaggcagattttg
gtcaaccgttactatggaaacatcagaccttcgggaagaagagagagcctcacgagcttt
ggcaatggcccgctgtcgccaggaggacccagcaagcctgggggaggagggggaggttcc
ggatccagccccatgagcaggggtgaaatgagcctggccgaggttcagtgccaccttgac
aaggagggggcctccaacctggtcatcgacctcatcatgaacgcatccagtgaccgagtg
ttccatgaaagcattcttctagccatygccctgctggaaggaggcaacaccaccatacag
cactcctttttctgccggttgacagaagacaagaagtcggagaaattcttcaaggttttc
tatgaccgaatgaaggtggcccagcaggaaatcaaggcaacagtgaccgtgaacaccagt
gacttgggaaataaaaagaaagatgacgaggtggacagggatgccccgtcacggaaaaaa
gccaaagagcctgcgacgcagattacggaagaggtgcgggatcagctcttggaggcctct
gccgccacccgcaaagccttcaccaccttcagaagggaagctgaccccgacgaccactac
cagtccggggagggcgcccaggccgcggcggacaagaacaaggacgacctggagatgagc
gcggtcatcaccatcatgcagcccatcctccgcttcctgcagctgctgtgcgaaaaccac
aaccgggacctccagaacttcctccgttgccaaaacaacaagaccaactacaatttggtg
tgcgagacactgcagtttctggactgtatttgtggaagcaccaccgggggtcttggtctt
ctgggactctatatcaacgaaaagaacgtggccctcatcaaccaaaccctggaaagtttg
actgaatactgtcaaggaccttgccatgagaatcagaactgcatagccacccatgaatcc
aatggcattgacatcatcacagccctgatcctcaatgacatcaaccctctgggaaagaag
aggatggaccttgtgttagaactgaagaacaatgcgtccaagttgctcctggccatcatg
gagagcaggcatgacagtgagaatgctgagcggatcctctataacatgaggcccaaggaa
ctggtggaagtgatcaagaaagcctacatgcaaggtgaagtggagttcgaggatggtgag
aatggtgaggacggagctgcctcccccagaaacgtgggacacaacatctacatcctagct
catcagttggctcgacataacaaagagcttcagaccatgctgaaacccggcggccaggtg
gatggagacgaagctctggagttttatgccaagcacacggcccagatagagattgtcagg
ttagaccgaaccatggagcagattgtcttccccgtgcccagtatatgtgaattcctaacc
aaagagtcaaaactacggatatactacaccacagagagggacgagcagggcagcaagatc
aacgacttcttcctgcggtccgaggacctcttcaatgagatgaattggcagaagaagctc
agagcccagcccgtcctgtactggtgcgcccgcaacatgtctttctggagtagcatttca
ttcaacctggccgtcctgatgaacctgcttgtggcgtttttctacccttttaaaggagtc
cgaggagggaccctggaaccgcactggtcgggactgctgtggacggccatgctcatctct
ctggccatcgtcatcgccctccccaagccccatggcatccgggccttaatcgcttccacg
attctccggttgatattttccgtcgggctacaacccacgctgtttcttttgggagctttc
aacgtctgcaataaaatcatttttctgatgagctttgtgggcaactgtgggacattcacc
agaggctaccgggccatggttctggatgttgagttcctttatcacctgctatacctgctg
atctgcgccatggggctcttcgtccatgagttcttctacagtttgctgctttttgattta
gtgtacagagaagagactctgctcaatgtcattaaaagcgtcactcgcaacggccggtcc
atcatcttgacggcggttctggctttgatcctggtttacctgttctccatagtgggctac
cttttcttcaaagatgacttcatcttggaagtagataggctgcccaatgaaacctctctt
ccagaagccagcgagagtttggcaagtgagttcctgtactctgacgtgtgtagggtggag
actggggagaactgctcctctccggcacccaaagaagagctggtccctgcagaagagaca
gagcaagataaagagcacacgtgcgagacgctgctgatgtgcatcgtcacggtgctgagt
cacgggctgcggagcgggggcggagtgggcgatgtgctcaggaagccatccaaagaggag
cccctctttgctgctcgagtgatctatgacctcttgttcttcttcatggtcatcatcatt
gtccttaatctgatttttggggtcatcattgacacctttgccgacctgaggagtgaaaaa
cagaaaaaagaggagatattaaagaccacgtgctttatctgcgggttggaaagagacaag
tttgacaacaagaccgtcacatttgaagagcacatcaaggaagaacacaacatgtggcat
tacctgtgcttcatcgtcctggtgaaagtgaaggactccacggagtacacagggcccgaa
agttacgtggcagagatgatcaaggaaagaaacctagactggttcccgaggatgagagcc
atgtccctggtcagcagcgattcagaaggagagcagaatgagctgaggaacctgcaggag
aagctggagtccaccatgaagcttgtcaccaacctctctggacagctgtcagaattaaag
gatcagatgacagaacaaaggaagcagaaacaaagaattggtcttctaggacatcctcct
cacatgaatgtcaacccacagcaaccagcataa

KEGG   Bos indicus (zebu cattle): 109576552
Entry
109576552         CDS       T04792                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04070  Phosphatidylinositol signaling system
biu04114  Oocyte meiosis
biu04210  Apoptosis
biu04218  Cellular senescence
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04713  Circadian entrainment
biu04720  Long-term potentiation
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04726  Serotonergic synapse
biu04728  Dopaminergic synapse
biu04730  Long-term depression
biu04742  Taste transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04922  Glucagon signaling pathway
biu04924  Renin secretion
biu04925  Aldosterone synthesis and secretion
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04929  GnRH secretion
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05017  Spinocerebellar ataxia
biu05020  Prion disease
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109576552 (ITPR3)
   04020 Calcium signaling pathway
    109576552 (ITPR3)
   04070 Phosphatidylinositol signaling system
    109576552 (ITPR3)
   04022 cGMP-PKG signaling pathway
    109576552 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109576552 (ITPR3)
   04210 Apoptosis
    109576552 (ITPR3)
   04218 Cellular senescence
    109576552 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109576552 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109576552 (ITPR3)
   04621 NOD-like receptor signaling pathway
    109576552 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    109576552 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    109576552 (ITPR3)
   04922 Glucagon signaling pathway
    109576552 (ITPR3)
   04929 GnRH secretion
    109576552 (ITPR3)
   04912 GnRH signaling pathway
    109576552 (ITPR3)
   04915 Estrogen signaling pathway
    109576552 (ITPR3)
   04921 Oxytocin signaling pathway
    109576552 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    109576552 (ITPR3)
   04918 Thyroid hormone synthesis
    109576552 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    109576552 (ITPR3)
   04924 Renin secretion
    109576552 (ITPR3)
   04925 Aldosterone synthesis and secretion
    109576552 (ITPR3)
   04927 Cortisol synthesis and secretion
    109576552 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109576552 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    109576552 (ITPR3)
   04971 Gastric acid secretion
    109576552 (ITPR3)
   04972 Pancreatic secretion
    109576552 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109576552 (ITPR3)
   04725 Cholinergic synapse
    109576552 (ITPR3)
   04728 Dopaminergic synapse
    109576552 (ITPR3)
   04726 Serotonergic synapse
    109576552 (ITPR3)
   04720 Long-term potentiation
    109576552 (ITPR3)
   04730 Long-term depression
    109576552 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    109576552 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    109576552 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    109576552 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109576552 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109576552 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109576552 (ITPR3)
   05012 Parkinson disease
    109576552 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    109576552 (ITPR3)
   05017 Spinocerebellar ataxia
    109576552 (ITPR3)
   05020 Prion disease
    109576552 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576552 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109576552 (ITPR3)
   05163 Human cytomegalovirus infection
    109576552 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109576552 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109576552 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:biu04040]
    109576552 (ITPR3)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109576552 (ITPR3)
Ion channels [BR:biu04040]
 Ligand-gated channels
  IP3 receptor
   109576552 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 109576552
NCBI-ProteinID: XP_019840744
Position
23
AA seq 2620 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGTGAQGRTGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRWVGTVGLGLAGVAWASIRTPSTPCSSVLPCMTHPSGD
PDPRQLFVIQLLEDLVFFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKA
PFRDKGGEGPLVRLEELSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQ
IGYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIA
IPVTQELICKCVLDPKNSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHH
EKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCM
ADEMLPFDLRASFCHLMLHXXVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRD
DKKNKFASTMEFVEDYLNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRL
TRTLLGIIDCVQAYEDPGGKNVRRSIQGVGHMMSTMVLNRKQSVFGGPSLPAGAGAPEPL
DRSKFEENEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADG
TAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMLLRVLIHLTMHDYAPLV
SGALQLLFKHFSQRQEVMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKK
GASKGEEGEXGPAKDKKERPTDEEGFLHPPGEKSSENYQIVKGVSGRVLGMCGVGEQMRK
KQQRLLKNMDAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLH
LFLTPGLLEAETMQHIFLNNYQLCSEIGEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEG
KYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDL
LAACAEGKNVYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEI
YTSNHIWTLFENFTLDMARVCSKREKRLADPALEKYVLTVVLDTISAFFSSPFSENSTSL
QTHQTIVVQLLQSTMRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSL
LSSGASCVAAAQRNASNYKTATRAFPRVMPTANQWDYKNIIEKLQDIITALEERLRPLVQ
AELSVLVDVLHWPELLFLEGSDAYQRCESGGFLSKLIQHTKDLMESEEKLCVKVLRTLQQ
MLLKKTKYGDRGNQLRKMLLQNYLQNRKSSSRGDLPDPMGTGLDQDWSAIAATQCRLDKE
GATKLVCDLITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHD
RMKRAQQETKSTVAVNMSDLGSQPREDREQADPTSKGRVASFSMPSSSSRYALGPSLRRG
HEVGERVQSNEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFL
DIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIIT
ALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKK
AYLQEEERENSDVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSL
NNKQLTQMLKSSAPVQEQEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEET
KHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNL
AVFINIIIAFFYPYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSIRPLIVALILR
SIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSV
LGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFL
KDDFILEVDRLPGNHSRANPLEMPHGAATFVNTCSGDNVDCVSGVSVPEVLAEDEEPDST
ERACDTLLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNL
IFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYF
IVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSSEGEGEQNEIRILQDKLSA
TMKLVSHLTAQLSELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 7863 nt   +upstreamnt  +downstreamnt
atgagcgagatgtccagcttcctccacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggttggtggatgaccgctgtgtggtggagccc
gcggctggtgacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagatcgccgacgtagtgctgctgcagaagttacagcacgcagcccagatggag
cagaagcagaacgacacggagaacaagaaggtgcacggggacgtcgtgaagtacggcagc
gtcatccagctcttgcacatgaagagtaacaagtacctgaccgtcaacaagcggctgcca
gccctgctggagaagaatgccatgagggtgacgctggacgccacgggcaaygagggctcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaacgtggttgtgggg
gacaaggtgatcctgaatccsgtcaacgccgggcagcctctgcacgccagcaattacgag
ctcagcgacaaygccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgttcatgcagttccgagaccacctggaggaggtgctgaaagggggagacgtg
gtgcggctgttccacgcggagcaggagaagttcctgacgtgcgacgagtacaggggcaag
ctgcaggtgttcctgcgcaccacgctgcgccagtctgccacatcagctacsagctccaac
gccctctgggaggtggaggtggtccaccacgacccgtgccgtggaggagctggccactgg
aacggcctctaccgcttcaagcacctggccaccggcaactacctggctgctgaggagaac
cccagctacaagggtgatgcctctgatcccaaggcagcaggcacgggtgcgcagggccgc
acaggtcgccggaacgctggggagaagatcaagtaccgcctggtggctgtgccccacggc
aacgacatcgcttccctcttcgagctggaccccaccacgctgcagaagaccgactccttc
gtgccccggtgggtgggcactgtgggcctggggttggcgggggttgcctgggctagtatc
cggacccccagtaccccctgctcctctgtccttccttgcatgacccatccctctggagat
ccagatccgaggcagctgtttgttatccagctgctggaggacctggtgttttttgtcagt
gatgtccccaacaatgggcagaacgtgctggacatcatggtcaccaagcccaaccgcgag
cggcagaagctgatgcgagagcagaacatcctcaaacagatcttcggcattctgaaggcc
ccgttccgtgacaaggggggcgagggccccctggtgcggctggaggagctgtcggaccag
aagaacgcgccctaccagcacatgttccgcctgtgttaccgagtgctgcgccattcccag
gaggactaccgcaaaaaccaggagcacatcgccaagcagttcgggatgatgcagtcccag
attggctatgacatcctggccgaagacaccatcactgccttgctgcacaacaaccgcaag
ctcctggagaagcacatcaccaaaacagaggtggagacctttgtcagcctggtgcggaag
aaccgggagcccaggttcctggactacctgtccgatctgtgtgtgtccaatcacatcgcc
atccccgtcacccaggagctcatctgcaagtgtgtgctggaccccaagaacagcgacatt
ctcatccagaccgagcttcggcccgtgaaggagatggcgcagtcccacgagtacctgagc
atcgagtactcagaagaggaagtgtggctcacrtggaccgacaagaacaacgagcaccac
gagaagagcgtccggcagctggctcaggaggcgcgggccggcaatgcccacgacgagaac
gtgctcagctattacaggtaccagctgaagctcttcgcccgcatgtgcctggaccggcag
tacctggccatcgacgagatctcccagcagytgggcgtcgacctcatcttcctgtgcatg
gcggacgagatgctgccctttgacctgcgcgcctccttctgccacctgatgctccacgnn
nacgtggaccgcgacccccaggagctggtcacrcccgtcaagttcgcccgcctctggacc
gagatccccacggccatcaccatcaaggactacgattccaacctcaacgcctcccgagac
gacaagaagaacaagttcgccagcaccatggagttygtggaggactacctcaacaatgtg
gtcagygaggccgtgcccttcgccaacgaggagaagaacaarctcacctttgaggtggtc
agcctggcscacaacctcatctactttggcttctacagcttcagcgagctgctgcggctc
acgcgcactctgctgggcatcatcgactgygtgcaggcctacgaggacccaggcggcaag
aatgtgcggcggtccatccagggcgtggggcacatgatgtccaccatggtgctgaaccgc
aagcagtctgtctttggtggccccagyttgcctgctggygccggtgcccctgagccgctg
gacaggagcaagtttgaggagaatgaagacattgtggtgatggagaccaagctgaagatc
ctggaaatactgcagttcatcctcaacgtccgcctggattaccgcatctcctacctgctg
tccgtcttcaagaaggagttcgtggaggtgtttcccatgcaggacagtggggccgatggc
acggcccctgccttcgactccaccacygccaacatgaacctggaccgcattggggagcag
gcggaggccatgtttggagtggggaagaccagcagcatgctggaggtggatgacgagggt
ggccgcatgctgctgcgcgtgcttatccacctcaccatgcacgactacgccccgctggtc
tcgggggccctgcagctgctcttcaagcacttcagccagcgccaggaggtcatgcacacc
ttcaagcaggtgcagctgctgatctcagcccaggacgtggagaactacaaggtgatcaag
tccgagctggaccgactgcggaccatggtggagaagtcggagctgtgggtggacaagaag
ggcgccagcaagggcgaggagggggagsccggccctgctaaagacaagaaggagcggccc
acagatgaggagggctttctgcatccgcctggggagaagagcagcgagaactaccagatc
gtcaagggcgtgagtggccgggtcctggggatgtgtggtgtgggggagcagatgaggaag
aaacagcagcggctactcaagaacatggacgcccacaaggtcatgctggacctgctgcag
atcccctacgacaagggcgatgccaagatgatggagatcctgcgctacacacaccagttc
ctgcagaagttctgcgcggggaaccccggcaaccaggccctgctacacaagcacctgcac
ctcttcctgacgccagggctgctggaggcggagaccatgcagcacatcttcctgaacaac
taccagctctgctccgagatcggggagcccgtcctgcagcacttcgtgcacctgctggcc
acgcacgggcgccacgtgcagtacctggacttcctgcacaccgtcatcaaggccgagggc
aagtacgtcaagaagtgccaggacatgatcatgaccgagctgaccaacgcaggcgacgac
gtggtcgtgttctacaacgacaaggcctcgctggcccacctgctggacatgatgaaggct
gcccgtgacggcgtggaggaccacagccccctcatgtaccacatctccctggtggacctg
ctggctgcctgtgccgagggcaagaatgtatacaccgagatcaagtgcacgtccctgctg
cccctggaggatgtggtgtctgtggtgacacacgaggactgcatcaccgaggtgaaaatg
gcctatgtgaatttcgtgaaccactgctacgtggacacggaggtggagatgaaggagatc
tacaccagcaaccacatctggaccctctttgagaacttcaccctggacatggctcgggtt
tgcagcaagcgtgagaagcgcctggctgaccccgccctggagaagtacgtgctgaccgtc
gtgctggacaccatcagtgccttcttcagctccccgttctctgagaacagcacctccctg
cagacgcaccagacgatcgtggtacagctgctgcagtccaccatgcggctgctcgagtgt
ccgtggctgcagcagcagcacaagggctccgtggaggcctgcatccggaccctcgccatg
gtggccaagggccgggccatctcgctgcccatggacttggatgcccacatcagctcgctg
ctcagcagtggtgccagctgtgtggctgccgcccagcggaatgcctccaactacaagacg
gccacgcgggccttcccccgtgtcatgcccactgccaaccagtgggactacaagaacatc
atcgagaagctgcaggacatcatcactgccctggaggagcggctgaggcccctggtgcag
gccgagctgtccgtgctggtggatgtcctgcactggcccgagctgctcttcctggagggc
agtgacgcctaccagcgctgcgagagcgggggcttcctgtccaagctgatccagcacacc
aaggacctcatggagtcggaggagaagctgtgcgtcaaggtgctaaggacgctgcagcag
atgctgctgaagaagaccaagtatggggaccggggcaaccagctgcgcaagatgctgcta
caaaactacctccagaaccggaagtccagctcgaggggggacctcccggaccccatgggc
accggcctggaccaagactggtcagcaatcgcagccactcagtgccggctggacaaggag
ggggccaccaagctggtgtgtgacctcatcaccagcaccaagaatgagaagatcttccag
gagagcatcggcctggccatccgcctgctggacggcggcaacaccgagattcagaaatcc
ttctacaacctgatgacgagcgacaagaagtcagagcgcttcttcaaggtgctgcacgac
cgcatgaagcgagcccagcaggagaccaagtccacggtggccgtcaacatgagcgacctg
ggcagccagccgcgtgaggaccgtgagcaggcagaccccacctccaaaggccgcgtggcc
tccttctcgatgcccagctcctcatcccgctatgcgttgggccccagcctgcgccggggg
cacgaggtgggcgaacgcgtgcagagcaacgagatgggcacgtccgtgctcatcatgcag
cccatactgcgctttctgcagctgctgtgtgagaaccacaaccgggacctgcagaacttc
ctgcgctgccagaacaataagacaaactacaacctggtgtgcgagacgctgcagttcctg
gacatcatgtgcggcagcactacgggcggcctggggctgctggggctctacatcaatgag
gacaacgtgggcctcgtcatccagaccctggagaccctcaccgagtactgtcagggtccc
tgccacgagaaccagacctgcatcgtgacgcacgagtccaacggcatagacatcatcacc
gcgctgattctcaatgacatcagccccctatgcaagtaccgtatggacctggtactgcaa
ctcaaggacaatgcctccaagctgctcctggctctgatggagagccggcacgacagtgaa
aaygccgagcgcatcctcatcagcctgcggccccaggagctggtggacgtcatcaagaag
gcctacctgcaggaagaggagcgtgagaactcagacgtgagcccccgtgaagtggggcac
aacatctacatcctggcgctgcagctctccaggcacaacaagcagctgcagcacctcctg
aagcctgtgaagcgcatccaggaggaggaggccgagggcatctcttccatgctcagcctc
aacaacaagcagctgacgcagatgctcaagtcctcagccccggtgcaggagcaggaagag
gaccctctggcctactatgagaaccacacctcccagatagagatcgtgcggcaggaccgc
agcatggagcagatcgtgttccccgtgcccggcatctgccagttcctgacggaggagacc
aagcaccgtctcttcaccaccaccgagcaggatgagcagggcagcaaagtgagcgacttc
ttcgaccagtcctccttcctgcacaacgagatggagtggcagcgcaagctccgcagcatg
ccactcatctactggttctcccgccgcatgactctctggggcagcatctccttcaacctg
gcagtctttatcaacatcatcattgccttcttctacccctacgtggagggcgcgtccaca
ggcgtgctgggctccccgctcatctcactgctcttctggatcctcatctgcttctccatc
gcggccctgttcaccaagcgctacagcatccgccccctcatcgtggcgctcatcctgcgt
tccatctattacctgggcattgggcccacgctcaacatcctgggtgccctcaacctgacc
aacaagatcgtgttcgtggtgagctttgtgggcaaccgtggcaccttcatccggggctat
aaggccatggtcatggacatggagttcctgtaccacgtgggctacatcctaacgagtgtc
ttgggcctcttcgcccacgagctcttctacagcatcctgctctttgacctcatctaccgc
gaagagacgctgttcaacgtcatcaagagcgtgacccgcaacggccgctccatcctgctg
accgccctgctggccctcatcctggtctacctcttctccatcgtcggcttcctcttcctc
aaggacgacttcatccttgaggtggaccggctgcccggcaaccactccagagccaacccc
ctggagatgccacatggagctgccacatttgtgaacacgtgcagtggggacaacgtggac
tgtgtctcaggagtctctgtgcctgaggtcctggcagaggacgaggagccagacagcacg
gagcgggcctgtgacaccctgctcatgtgcatcgtcaccgtcatgaaccacgggctgcgc
aacggcggtggcgtgggggacatcctccgcaagccctccaaagacgagtctctctttccc
gcccgagtggtctacgacctcctgttcttcttcatcgtcatcatcatcgtgctgaacctc
atctttggggtgatcattgacacctttgccgacttgcgcagcgagaagcagaagaaggaa
gagattctcaagaccacgtgcttcatctgcggtctggagagggacaagtttgacaacaag
accgtgtcgtttgaggagcacatcaagtttgagcacaacatgtggaactacctgtacttc
atcgtgctggtccgcgtgaagaacaagacggactacacggggccggagagctacgtggcc
cagatgatcaagaacaagaacctggactggttcccccggatgcgggccatgtccctggtg
agcagcgagggggaaggggagcagaacgagatccgcatcctccaggacaagctcagcgcc
accatgaagctggtgtcccacctcaccgcccagctcagcgagctcaaggagcagatgacg
gagcagaggaaacgcaggcagcgcctgggctttgtggatgtgcagaactgcatgagccgc
tga

DBGET integrated database retrieval system