KEGG   Bos indicus (zebu cattle): 109558606
Entry
109558606         CDS       T04792                                 

Gene name
VWF
Definition
(RefSeq) von Willebrand factor
  KO
K03900  von Willebrand factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04610  Complement and coagulation cascades
biu04611  Platelet activation
biu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109558606 (VWF)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109558606 (VWF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109558606 (VWF)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109558606 (VWF)
   04611 Platelet activation
    109558606 (VWF)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109558606 (VWF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109558606 (VWF)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109558606 (VWF)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Others
   109558606 (VWF)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109558606 (VWF)
SSDB
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWA_2 VWC
Other DBs
NCBI-GeneID: 109558606
NCBI-ProteinID: XP_019815512
Position
5
AA seq 2761 aa
MFPTRLARLLLAVAXTLPGALCGEGALGKSSMARCSLFGADFINTFDESMYSFSGDCSYL
LAGDCKTHSFSIVGEWLHPPEPFSTGTLTSDPYDFANSWALSSEEQRCPRVSPPSSSCNX
SSELQKGLWEKCQLLKTASVFARCHALVDPEPFVALCERMLCACAQGLRCPCPVLLEYAR
ACAKQGMLLYGWADHSSCRPDCPTGMEYKECVSPCHRTCRSLSITEVCREQCVDGCXCPE
GQLLDEGRCVESTECPCVHAGKPYPPGASLSRDCNTWTDPLGLDLPGPEEWSLSRVLLWG
PFLDRGGEKPRKCPLLGHPPGDPLGHPLSPPPVFPGECLITGQSHFKSFDDRHFTFSGVC
QYLLAQDCQDHSFSVVIETVQCADDPDAVCTRSVTVRLPSPHHGLLKLKHGGGVALDGQD
IQIPLLQGDLRIQHTVTASLQLNFGEDLQIDWDGRGRLLLKLSPVYAGRTCGLCGNYNGN
QRDDFLTPAGLVEPLVEHFGNSWKLRADCEDLQEQPSDPCSLNPRLTKFADQACAILTSP
KFEACHSAVSPLPYLRNCRYDVCACSDGRDCLCDAVANYAAACARRGVHVGWREPSFCAL
SCTHGQVYQQCGTPCNLTCRSLSHPDEECTEVCLEGCFCPPGLFLDETGSCVPKAQCPCY
YDGEIFQPEDIFSDHHTMCYCEDGFMHCSTSGAPGSLLPEAVLSSPLSHRSKRSLSCRPP
MVKVVCPADNPRAEGLECTKTCQNYDLECMSTGCVSGCLCPPGMVRHENRCVALERCPCF
HQGREYAPGDRVKVDCNSCVCQDRKWNCTDHVCDASCSALGLAHYFTFDGLKYLFPGECQ
YVLVQDHCGSNPGTFRVLVGNEGCSVPSLKCRKRITILVEGGEIELFDGEVNVKTPMKDE
THFEVVESGRYITVLLGKALSVVWDGHLAVSVFXKRTYQERVCGLCGNFDGVQNNDLTSS
SLQVEENPVDFGNSWKVSPQCADTQKVRLDSAPAICHDNVMKQTMVDSSCRVLTSDVFRE
CNRLVNPEPYLDVCIYDSCSCESIGDCACFCDTIAAYAHECAQHGQVVTWRTATLCPQNC
EERNLKESGYQCEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTC
VNPEDCPVCQVEGRRLASGKKVTLNPGDPEHCQICHCDGVSLTCEACKEPGGPPPTEGPV
IPTTPYVEDIPEPPLHDFFCSKLLDLVFLLDGSSKLSEADFETLKAFVVGMMERLHISQK
RIRVAVVEYHDGSHAYLALQDRKRPSELRRIAGQVKYAGSEVASTSEVLKYTLFQIFGRI
DRPEASRVALLLTASQEPPRLARNLVRYVQGLKKKKVSVVPVGIGPHASLKQIRLIEKQA
PENKAFVLSGVHELEQRMDDIVGYLCDLALEVPAPTLTQHPLAAQVTVAPQLLGPSLPGP
KRSSVVLDVAFLLEGSDEVGEANFNRSAEFVEEVIRRMDVGQDGIHVTVLQYSYVVTVEH
SFREPQSKDVVLQRLREVRYRGGNQTNTGLALQYLSEHSFSASQGDREQAPNLVYMVTGS
PASDKIQRMPGDIQLVPIGVGPRVDVQELERVSWPQTPIFIQDFERLPREAPDLVLQRCC
SEDGPHLPTLAPAPDCSQPLDVVLLLDGSSTSPASYFDEMKSFAKAFISKANLGPQLTQV
SVLQYGSNTNVDVPWDIHVDKAHLLXLVDPMQREGGPSQVGQALSFAARYITSQVHGARP
SASKVVVILVTGSSMDSVEAAAAAARSNRVAVFPIGIGDQYDAAQLRVLAGPGASSNVAE
LQRIEDLPSMVALGNSFFQRLCSGFVSVCVDEDGNERRPGDVWTLLDQCHTVTCLPDGQT
LLKSHRVNCDQGPQPSCPDGQTPLRMEEACGCRWACPCVCTGSSTRHIVTFDGRNFKLTG
NCSYVLFHNKEQDLEVILHNGFCSAGARQACMKSVEVKQNGLSVELRSNMEVMVNGRLVS
VPYLGGDMEVRVYGTIMFEVRFMGHILSFTPQNNEFQLQLRPKIFASKTYGLCGFCDENG
ANDFMLRDGTVTEDWKTLVREWTVQQPGQTCPLGPEEPCPISQGSRCQVLLSELFAECHK
VLAPATFHAMCQQDSCQQEQVCEAIASYAHLCRTKGVCVDWRTPDFCAVSCPPSLIYNHC
ESGCPRQCEGNSSSCGDHPLEGCFCPPHQVMLEGSCVPEEACTQCVGDDGIRHQLLETWV
PDHQPCQICTCLSGRXVNCTTQPCPSAGVPTCGPCEVARXRQSTXQCCPEYECVCDLVSC
DVPPVPNCEDGLQPVLANPGECRPSFTCVCRKEECPKGSPPSCPPHRMPALRKTRCCDEY
ECACNCTNSTVSCPLGYLASTITNDCXCTTTTCLPDKVCVHRGTIYPVGQFWEEGCDTCT
CTDLEDAVMGLRVAQCSQKPCADICRPGFTYVLREGECCGRCLPSACEVVTGSPRGDSQT
QWKSVGSHWASPENPCLIHECVRVEEEVFVQQRNVSCPQLNVPVCPLGFQLRCQTLGCCP
TCRCEPVQACVLNGTIIGPGKTVMVDACMTCRCHVQAGVISGFKLECRKTTCQACPAGYM
EEKLQGECCGRCLPTACTIQLRGGQIMMLKRDETLQDGCDSHFCKVNKRGEFIWEKRVMS
CPPFNEHKCLAEGGEIMKIPGTCCDTCEEPECKDITARVKSIKVGDCKSEDEVDIHYCQG
RCTSKALYSIDTEDVQDQCSCCSPTRTEPMXVPLRCTNGSIIHHVVLNALQCQCSSRKCS
P
NT seq 8286 nt   +upstreamnt  +downstreamnt
atgtttcccaccaggctcgcgaggctgctgcttgctgtggccytcactttgccaggggcc
ctttgtggagaaggggctcttggcaagtcatcgatggcccggtgcagcctcttcggagct
gacttcatcaacacctttgatgagagcatgtacagcttctcgggagactgcagttacctc
ctggcaggggattgcaagacacactccttctcaatcgtaggtgaatggctccatcctcct
gaacctttctctacaggaaccctgacctcagacccgtacgactttgcaaactcctgggcc
ctgagcagtgaggagcagcggtgcccacgggtgtcccctcccagcagctcctgcaacrtc
tcctccgagctgcagaagggcctgtgggagaagtgccagcttctgaagacggcctccgtg
ttcgcccgctgccacgccctggtggaccccgagccttttgtggccctgtgtgagcggatg
ctgtgcgcatgcgcccaggggctgcggtgcccctgccctgtgctcctggagtacgcccgc
gcctgcgccaagcaggggatgctgctgtacggctgggcggaccacagctcctgccgacca
gactgccccacgggcatggagtacaaggagtgtgtgtccccatgccacaggacctgccgg
agcctgagtatcaccgaagtgtgtcgggagcagtgtgtggatggctgyrgctgccctgag
ggacagctcctggatgaaggccgctgtgtggaaagtactgagtgtccctgtgtgcatgct
ggaaagccataccctccaggagcctccctctcacgagactgcaacacctggactgaccca
ctgggccttgacctcccagggccagaggagtggagcctgagtagagtcctcctgtggggc
ccctttctagaccgtggtggggagaaacccagaaagtgcccactactgggacacccccca
ggggacccactgggacaccccctctcccctccccctgtctttccaggagagtgtctcatc
acaggacaatcccacttcaagagctttgacgacaggcacttcaccttcagcggggtctgc
cagtacctgctggcccaggactgccaggatcactccttctccgtcgtcatagagactgtc
cagtgtgccgacgaccctgatgcggtctgcacccgctccgtcaccgtccgcctgcccagc
ccgcaccacggcctcctgaagctgaagcacgggggtggagtcgccctggacggccaggat
atccagattcccctcctgcaaggtgacctccgcatccagcacactgtgacggcctccctg
cagctcaacttcggggaggacctgcagatagactgggacggccgtgggaggctgctgctg
aagctgtcccctgtctacgcggggaggacgtgcgggctgtgcgggaattacaacggcaac
cagagggacgacttcctgacgcccgcgggcctggtsgagcccctggtggagcacttcgga
aactcctggaagctgcgcgcagactgtgaggacttgcaggagcagcccagtgacccctgc
agcctcaayccgcgcctgaccaagttcgcagaccaggcctgcgccatcctgacgtccccc
aagttcgaggcctgccacagcgccgtgagcccgctgccctacctgcgcaactgccgctac
gacgtgtgcgcctgctccgacggcagagactgcctgtgcgacgcggtggccaactacgca
gcggcctgcgcccggaggggcgtgcacgtcggatggcgggagcccagcttctgtgcgctg
agctgcacacacggccaggtgtaccagcagtgtgggaccccctgcaacctcacctgccgc
tcactctcccacccggacgaggaatgcaccgaggtctgtctggagggctgcttctgcccg
ccrgggctcttcctggacgagacagggtcctgtgtgcccaaggcccagtgcccctgttac
tacgacggtgagatcttccaacccgaagacatcttctcggaccatcacaccatgtgctac
tgcgaagatggcttcatgcactgctccacgagtggagccccagggagcctgctgcctgaa
gcagtcctcagcagccccctgtcccaccgcagcaaaaggagcctgtcctgccggcccccc
atggtcaaggtggtgtgccctgctgacaacccgagggccgaagggcttgaatgcaccaaa
acctgccagaactatgacctggaatgcatgagcactggctgtgtgtccggctgcctctgc
cccccgggcatggtccggcatgagaacaggtgtgtggccctggaaaggtgcccttgcttc
caccagggcagagagtatgcccccggagacagggtgaaggtcgattgcaacagctgcgtc
tgtcaggaccggaagtggaactgtacggaccacgtgtgtgatgctagctgctctgccctg
ggcctggctcactacttcacctttgatgggctcaagtacctgttcccgggggagtgccag
tatgtcctggtgcaggaccactgtggtagtaaccccggcaccttccgggtcctggtgggg
aatgaggggtgcagcgtcccctccctgaagtgcaggaagcgcatcaccatcctggtggaa
ggaggagaaatagagctgtttgacggggaggtgaacgtgaagacgcccatgaaggatgag
acrcactttgaggtggtggagtctggccggtacatcactgtgctgctgggcaaggccctc
tctgtggtctgggacgggcacctggccgtctccgtgttcmtgaagcggacgtaccaggag
cgggtatgcggcctgtgtgggaatttcgatggcgtccagaacaatgacctcaccagcagc
agcctccaagtggaggaaaaccccgtggactttgggaattcctggaaagtgagcccacag
tgygctgacacccagaaagtgcggctggactcggcccctgccatctgccatgacaacgtc
atgaagcagaccatggtggattcctcctgcagggtcctcaccagtgatgttttccgagag
tgcaacaggctggtgaaccccgagccgtacctggatgtttgcatctatgacagctgctcc
tgcgagtccatcggggactgcgcctgcttctgtgacaccatcgctgcctaygcccatgag
tgtgcccagcacggccaggtggtgacctggaggacagccacactgtgcccccagaattgt
gaggagcggaacctgaaggagagtgggtaccaatgcgagtggcgctacaacagctgtgct
ccggcctgtccagtcacgtgccagcacccggagcccctggcctgccccgtgcagtgcgtg
gagggctgccacgcacactgcccacccgggaaaatcctggacgagcttttgcagacctgc
gtcaaccccgaggactgccctgtgtgccaggtggagggccggcgcttagcctccgggaag
aaagtgaccctgaaccctggggaccctgagcattgccagatctgtcactgtgatggtgtc
agcctcacttgtgaagcctgcaaggagccaggaggcccgccccccaccgaaggcccggtc
atccccacaaccccatatgtggaggacatcccggagccgcccctgcatgacttcttctgc
agcaaactcctggacctggtcttcctgctggatggctcctccaagctgtccgaggctgac
ttcgagacgctgaaggcattcgtggtgggcatgatggagcgtctgcacatttcccagaaa
cgcatccgtgtggccgtggtggagtaccatgatggctcccatgcctacctcgcgctgcaa
gaccggaaacggccatctgagcttcggcgcattgccgggcaggtgaagtatgcgggcagc
gaggtggcttccaccagcgaggtcttgaagtacacgctcttccagatcttcggcaggatt
gaccggcctgaggcctctcgcgtggccctgctgcttacggccagccaggaaccccccagg
ctggcccggaacttggtccgctacgtccagggcctgaagaagaagaaggtctccgtggtc
cccgtgggcatcgggccccacgccagcctcaagcagatccgcctcattgagaagcaggca
cctgagaacaaagcctttgtgctaagtggygtgcacgagctggagcagcggatggacgat
attgtcggctacctctgcgacctcgccctcgaggtgcctgccccgaccctgacgcaacat
cccctcgccgcacaggtcactgtggcgccgcagctcctgggtccttcgctgccgggaccc
aagaggagctctgtggtcctggatgtggcattcctcctggaaggctcggacgaggtgggc
gaggccaacttcaacaggagcgcagagtttgtggaggaggtgatccgacgcatggacgtg
ggccaggacggcatccacgtcacagtgctgcagtactcatatgtggtgactgtggagcac
tccttcagggagccacagtccaaggacgtggtcctgcagcgactccgtgaagtccgctac
cgaggtggcaaccagacaaacacggggctggccctgcagtacttgtcggagcacagcttc
tctgccagccagggggaccgggagcaggcgcccaacctggtctacatggtgacaggaagc
ccggcctcggacaagatccagcggatgcctggagacatccagctggtgcccatcggcgtg
ggcccccgcgtggatgtgcaggagctggagagggtcagctggccccagacccccatcttc
atccaggacttcgagaggctcccccgagaagctccagatctggtgctgcagcggtgctgc
tccgaagacggcccgcacctccccaccctcgcccctgccccagactgcagccagcccctg
gatgtagttctcctcctggatggctcctccacctctccagcctcttactttgacgaaatg
aagagtttcgccaaggcgttcatctcaaaagccaacctaggccctcagctcacccaggtg
tcrgtcctgcagtacggaagcaacaccaacgttgacgtgccctgggacatacacgtggac
aaagcccacctgctgarccttgtggaccccatgcagcgcgagggaggccccagccaagtt
gggcaggcactgtccttcgcggcacgctacatcacgtcccaagtccacggtgccaggccc
agtgcctccaaggtggtggtgatcctggtcacaggctcctccatggattcagtggaggcg
gccgccgctgctgccagatccaaccgagtggctgtgttccccatcgggattggggaccag
tatgatgcagcccagctgagggtcttggcgggtccgggggccagctccaacgtggcagag
ctccagcggatcgaagacctccccagcatggttgcccttggcaactctttcttccagagg
ctatgctctgggttcgtcagtgtttgcgtggatgaggacgggaatgagaggaggcctggg
gacgtctggaccttgctggatcagtgccacacggtgacttgcctgccagatggccagacc
ttgctgaagagtcaccgggtcaactgcgatcaggggccacagccatcatgccccgacggc
cagaccccrctcaggatggaggaagcctgtggctgccgctgggcctgtccctgtgtgtgc
acaggcagctccactcggcacatcgtgacctttgatggacggaatttcaagctgaccggc
aactgctcatatgttctgtttcacaacaaggagcaggacttggaggtgattctccataat
ggattctgcagcgctggggcgaggcaggcctgcatgaaatctgtggaggtgaagcagaac
ggcctctcggttgagctccgcagcaacatggaggtgatggtgaatgggagactggtctct
gtcccttacctgggtggggacatggaggtcagagtctatggtaccatcatgttcgaggtc
agattcatgggccacatcctctccttcacsccacaaaacaacgagttccagctgcagctg
aggcccaagatctttgcctcaaagacgtatggtctctgtgggttctgtgatgagaacggg
gccaatgacttcatgctgagggatggcacggtcactgaggactggaagacactggtccgg
gagtggacggtgcagcagccggggcagacatgcccgctgggccccgaggagccgtgcccc
atctcccagggctcccgctgccaggtcctcctctctgagctatttgctgagtgccacaag
gtccttgctccagccacatttcatgccatgtgccagcaggacagttgccagcaggagcaa
gtgtgtgaagccattgcctcttatgcccacctctgccggaccaagggggtgtgtgtcgac
tggaggactcctgatttctgtgctgtgtcctgcccgccctccctgatctacaaccactgt
gagagtggctgcccccggcagtgtgagggcaactcgagctcctgcggggaccatcccttg
gaaggctgcttctgccctccgcaccaagtgatgctggaaggcagctgtgtccctgaggag
gcctgtacccagtgcgtcggtgacgatggcatccggcaccagctcctggaaacgtgggtc
ccagaccatcagccctgccagatctgcacrtgcctcagcgggcggaakgtcaactgcacg
acacagccctgcccctcggccggagtgcccacgtgcggcccatgtgaggtggcccggytc
cggcagagcacgmagcagtgctgtcccgagtaygagtgtgtgtgtgacttggtgagctgt
gacgtgcccccggtgcctaactgygaagacggcctccagccggtgctggccaatcctggc
gagtgcagacccagcttcacctgtgtctgcaggaaggaggaatgcccgaaggggtcccca
ccctcctgccccccgcaccggatgcccgcccttcggaagacccggtgctgtgacgagtac
gagtgtgcttgcaactgcaccaactccacggtgagctgcccgctggggtacctggcctcc
accatcaccaacgactgcrgctgcaccaccaccacctgcctccccgacaaggtgtgcgtc
caccgaggcaccatctaccccgtgggccagttctgggaggagggctgtgatacctgcacc
tgcacggatctggaggatgctgtgatgggcctgcgcgtggcccagtgctcccagaaaccc
tgcgcggacatctgccggccgggcttcacctacgtcctccgcgagggagagtgctgtgga
aggtgcctgccgtcggcctgcgaggtggtgaccggctccccgcggggggactcccagacc
cagtggaagagtgttggctctcactgggcctcccccgagaacccctgcctcatccacgag
tgcgtccgagtcgaggaggaggtcttcgtgcagcagaggaaygtctcctgcccgcagctg
aatgtccccgtctgcccgttgggcttccagctgcgctgtcagaccttgggctgttgcccc
acctgtcgctgcgagcccgtgcaggcttgcgtcctcaacggcaccatcatcgggccyggg
aagactgtgatggttgacgcatgcatgacctgccgctgccacgtccaggcaggggtcatc
tctggattcaagctggagtgcaggaagaccacctgccaggcctgccctgcgggttacatg
gaagagaagctccagggcgaatgctgtgggagatgcctgcctacggcgtgcaccattcag
ctacgagggggacagatcatgatgctgaagcgtgatgagacactccaggatggctgtgac
agtcacttctgcaaagtcaacaagagaggagagttcatttgggagaagagggtcatgagc
tgcccgcccttcaacgaacacaaatgcctggctgaggggggggaaatcatgaaaatccct
ggcacgtgctgtgacacatgtgaggagcctgagtgcaaggacatcacagccagggtgaag
tccatcaaggtgggagactgcaaatctgaagaygaagtggacattcactactgccaggga
agatgcaccagcaaagccctgtactccatcgacacggaggaygtgcaggaccagtgttcc
tgctgctcgccgacgcgcacggagcccatgycagtgcccctgcgctgcaccaacggctcc
atcatccaccatgtggtcctcaacgccctgcagtgccagtgctcctccaggaaatgcagc
ccgtga

DBGET integrated database retrieval system