KEGG   Bos indicus (zebu cattle): 109558673
Entry
109558673         CDS       T04792                                 

Definition
(RefSeq) glycosylation-dependent cell adhesion molecule 1
  KO
K06815  glycosylation dependent cell adhesion molecule 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109558673
SSDB
Motif
Pfam: GLYCAM-1 Coleoptericin
Other DBs
NCBI-GeneID: 109558673
NCBI-ProteinID: XP_019815569
Position
5
AA seq 153 aa
MKFLCVLLLASLAATSLAILNKPEDETHLEAQPTDASAQFIRNLQISNEDLSKEPSISRE
DLISKEQIVIRSSRQPQSQNPKLPLSILKEKHLRNATLGSEETTEHTPSDASTTEGKLME
LGHKIMRNLENTVKETIKYLKSLFSHAFEVVKX
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaaattcctctgcgtcctgcttctggccagcttggccgccacctctctcgccatcctt
aacaagccagaagatgaaacccacctggaggctcagcccactgatgcctctgctcagttc
atcaggaacctccagatctccaatgaggacctttctaaggagccttccatctccagagaa
gatttgatttccaaagagcaaattgtgatcagatcttccaggcaaccacagagtcagaat
cccaagctccctctgtccatactcaaggaaaaacatctcagaaatgctacccttggatca
gaagagactacagaacacactcccagtgatgcatccaccacagaaggaaaactgatggag
ctcggtcataaaatcatgaggaatctggaaaacacagtgaaagaaaccataaaatatctg
aaaagcctattctctcatgcctttgaagtcgtgaagmcgtag

DBGET integrated database retrieval system