KEGG   Bos indicus (zebu cattle): 109558719
Entry
109558719         CDS       T04792                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03050  Proteasome
biu04060  Cytokine-cytokine receptor interaction
biu04066  HIF-1 signaling pathway
biu04217  Necroptosis
biu04350  TGF-beta signaling pathway
biu04380  Osteoclast differentiation
biu04612  Antigen processing and presentation
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04657  IL-17 signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04940  Type I diabetes mellitus
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05200  Pathways in cancer
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
biu05322  Systemic lupus erythematosus
biu05323  Rheumatoid arthritis
biu05330  Allograft rejection
biu05332  Graft-versus-host disease
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    109558719 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109558719 (IFNG)
   04630 JAK-STAT signaling pathway
    109558719 (IFNG)
   04066 HIF-1 signaling pathway
    109558719 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109558719 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109558719 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109558719 (IFNG)
   04612 Antigen processing and presentation
    109558719 (IFNG)
   04660 T cell receptor signaling pathway
    109558719 (IFNG)
   04658 Th1 and Th2 cell differentiation
    109558719 (IFNG)
   04659 Th17 cell differentiation
    109558719 (IFNG)
   04657 IL-17 signaling pathway
    109558719 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109558719 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109558719 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109558719 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109558719 (IFNG)
   05323 Rheumatoid arthritis
    109558719 (IFNG)
   05321 Inflammatory bowel disease
    109558719 (IFNG)
   05330 Allograft rejection
    109558719 (IFNG)
   05332 Graft-versus-host disease
    109558719 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109558719 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109558719 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109558719 (IFNG)
  09172 Infectious disease: viral
   05164 Influenza A
    109558719 (IFNG)
   05160 Hepatitis C
    109558719 (IFNG)
   05168 Herpes simplex virus 1 infection
    109558719 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109558719 (IFNG)
   05144 Malaria
    109558719 (IFNG)
   05145 Toxoplasmosis
    109558719 (IFNG)
   05140 Leishmaniasis
    109558719 (IFNG)
   05142 Chagas disease
    109558719 (IFNG)
   05143 African trypanosomiasis
    109558719 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:biu03051]
    109558719 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109558719 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109558719 (IFNG)
Proteasome [BR:biu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109558719 (IFNG)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interferons
   109558719 (IFNG)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Haparin
  Cytokines
   109558719 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 DnaGprimase_HBD Cep57_MT_bd PRANC
Other DBs
NCBI-GeneID: 109558719
NCBI-ProteinID: XP_019815611
Position
5
AA seq 166 aa
MKYTSYFLALLLCXLLGFSGSYGQGQFFREIENLKEYFNASSPDVAKGGPLFSEILKNWK
DESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKKLIQ
IPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagctatttcttagctttactgctctgtgkgcttttgggtttttctggt
tcttatggccagggccaattttttagagaaatagaaaacttaaaggagtattttaatgca
agtagcccagatgtagctaagggtgggcctctcttctcagaaattttgaagaattggaaa
gatgaaagtgacaaaaaaattattcagagccaaattgtctccttctacttcaaactcttt
gaaaacctcaaagataaccaggtcattcaaaggagcatggatatcatcaagcaagacatg
tttcagaagttcttgaatggcagctctgagaaactggaggacttcaaaaagctgattcaa
attccggtggatgatctgcagatccagcgcaaagccataaatgaactcatcaaagtgatg
aatgacctgtcrccaaaatctaacctcagaaagcggaagagaagtcagaatctctttcga
ggccggagagcatcaatgtaa

DBGET integrated database retrieval system