KEGG   Bos indicus (zebu cattle): 109558903
Entry
109558903         CDS       T04792                                 

Gene name
C1S
Definition
(RefSeq) complement C1s subcomponent
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05133  Pertussis
biu05150  Staphylococcus aureus infection
biu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109558903 (C1S)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    109558903 (C1S)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109558903 (C1S)
   05150 Staphylococcus aureus infection
    109558903 (C1S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109558903 (C1S)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109558903 (C1S)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     109558903 (C1S)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109558903 (C1S)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    109558903 (C1S)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA Trypsin_2 CUB_2 EGF hEGF
Other DBs
NCBI-GeneID: 109558903
NCBI-ProteinID: XP_019815796
Position
5
AA seq 695 aa
MNKLPEMWCIVLFSLVAWVYAEPTMYGEILSPNYPQXYPNEVEKSWDIEVPAGYGIHLYF
THLDIELSENCSYDSVQIMSGGHEEGKLCGRRTNKNSNSPVVKEFHIPYSKLQVIFRSDF
SNEERFTGFAAYYVAEDIDECTAFADAPCSHFCNNFLGGYFCSCPPEYFLHEDKKNCGVN
CSGNVFTTMTGEVESPNYPSPYPESSRCDYQIQLEEGFRVVVTMRREDFDVEPADSEGHC
PDSLLFVAGDQHFGPYCGNGFPGPLTIETQSSALNIIFQTDGSEQRKGWKFRYHGDPIPC
PKEVTANSFWEPERAKYVFRDVVKITCVDGFEVVQGSVGSPSFYSTCQSNGKWSNSKLRC
QPVDCGAPEPIQHGRVEDPESTLFGSITRYSCEMPYYSMEYEGSEVYHCSGNGSWVNKVL
GIEPPKCIAVCGTPSEPFRSTQRIFGGSIAKIENFPWQVFFSNPWAGGALIDEYWVLTAA
HVVEGNDIPVMYVGSSSVVTSQLSNAQMLTAERVFIHPGWEVLDPSITRKNFDNDIALVR
LRDPVKMGPKVAPICLPGTSSEYDPPENVLGLISGWGRTNVKSHVIKLRGAKLPVAPLSK
CREMKGVNPGIDISSFVFTENMICAGNDKGVDSCDGDSGGAFAVQDPKENKPKFYVAGLV
SWGPQCGTYGIYTRVKNYVDWIRKTMQEYSAPSVD
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgaacaaattgccagagatgtggtgcattgtcctgttttcccttgtggcctgggtttat
gccgagcctactatgtatggagagattctatcccccaactaccctcaggygtaccccaac
gaggtcgagaagtcttgggacatagaagtccctgcagggtacgggatccacctttacttc
acccacctggatatagagttgtctgagaactgctcctatgattcagtgcagataatgtcg
ggaggccatgaagaagggaaactctgtggacggaggaccaacaagaattcaaactcccca
gtggtgaaagagttccacatcccatacagtaaattgcaggtgatcttccggtcggacttc
tccaacgaggagcgtttcaccgggtttgctgcgtactatgttgctgaggatatagatgag
tgcacagcctttgcagatgctccttgcagccacttctgcaataacttccttggtggttac
ttctgctcctgccctccagaatacttcctccatgaagacaagaagaactgtggagtcaat
tgcagtggaaatgtattcaccacaatgactggggaggttgaaagtcctaattaccccagt
ccatacccagagagctcaaggtgtgactatcagatccagttggaggaggggttccgagtg
gtggtgaccatgaggagagaagactttgatgtggaaccagctgactccgagggccactgt
cccgacagtttgctctttgtggcaggagaccagcattttggtccttactgtgggaacggc
tttcctgggccactaacaattgaaacccagagcagtgctctgaatatcatcttccaaact
gatggatcagaacaaagaaagggatggaaatttcgttaccatggagatccaatcccttgt
cctaaagaagtcactgccaattccttctgggagcctgagagagcaaaatatgtgttcaga
gatgtggtgaagataacctgtgtggatgggtttgaagttgtgcagggaagtgttggttcc
ccatctttctactctacttgtcaaagcaatggaaagtggagtaattccaagttgcggtgt
caacccgtggactgtggcgctcctgaacccattcagcatggtagagttgaagatccagaa
agtactctatttggttccatcactcgctactcttgtgagatgccatattacagcatggaa
tatgaagggagcgaggtgtatcactgcagtggcaatgggagctgggtgaacaaggtgctg
ggcatagagccgccgaaatgcattgcagtctgtggcacccccagcgagccttttagatca
acacaaagaatatttggaggctccattgcgaagattgaaaatttcccctggcaagtcttc
ttctcgaacccatgggctggtggggctctcattgatgaatactgggtgctgacagctgcc
catgtcgtggagggaaacgatatcccagtgatgtatgttgggtcctcctcagtggtcacc
tcacaattgtcaaatgctcagatgctcactgcagagagagtgtttatccatccaggatgg
gaggtcctggatccttcgataacacgaaagaattttgacaatgacattgcgctggtgcgg
ctgagagacccagtgaaaatgggacccaaggtcgcccctatctgcctaccaggcacctcc
tcagaatatgaccctccggagaacgtcctgggcctgatctcaggttggggtcgaacaaat
gtcaaaagtcatgttattaagctcagaggggcaaagctacccgttgctcccttatccaaa
tgccgggagatgaagggggtcaatcctggaatagatatcagttcttttgttttcactgag
aacatgatctgtgccggtaatgacaagggtgttgacagctgtgacggggacagtggtggg
gcctttgctgtacaggaccctaaggaaaacaagcccaaattctatgttgctggtttggtg
tcctggggcccccagtgtgggacctatgggatctacactcgagtcaagaactacgttgac
tggataaggaagacaatgcaggagtatagtgcccccagtgtagactaa

DBGET integrated database retrieval system