KEGG   Bos indicus (zebu cattle): 109558922
Entry
109558922         CDS       T04792                                 

Gene name
CD4
Definition
(RefSeq) T-cell surface glycoprotein CD4
  KO
K06454  T-cell surface glycoprotein CD4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04514  Cell adhesion molecules
biu04612  Antigen processing and presentation
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu05135  Yersinia infection
biu05166  Human T-cell leukemia virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109558922 (CD4)
   04514 Cell adhesion molecules
    109558922 (CD4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109558922 (CD4)
   04612 Antigen processing and presentation
    109558922 (CD4)
   04660 T cell receptor signaling pathway
    109558922 (CD4)
   04658 Th1 and Th2 cell differentiation
    109558922 (CD4)
   04659 Th17 cell differentiation
    109558922 (CD4)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109558922 (CD4)
  09163 Immune disease
   05340 Primary immunodeficiency
    109558922 (CD4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109558922 (CD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109558922 (CD4)
   05170 Human immunodeficiency virus 1 infection
    109558922 (CD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109558922 (CD4)
CD molecules [BR:biu04090]
 Proteins
  109558922 (CD4)
SSDB
Motif
Pfam: CD4-extracel C2-set ig Ig_3 V-set I-set Ig_2 Receptor_2B4 Ig_4 Ig_6 C1-set P_proprotein
Other DBs
NCBI-GeneID: 109558922
NCBI-ProteinID: XP_019815824
Position
5
AA seq 395 aa
MGPGTSLRHLFLVLQLAMLXAGTQGKTVVLGEAGDXAELPCQASQKKNMVFSWKDSSQSN
ILGKRGLFFYKGTTELSHRVESKKNLWDQGSFPLIIKNLQVTDSGTYTCEVDKKTLEVEL
QVFRLTASSDTHVLLGQXLTLTLESPSGSNPSVQWKGPGBNNKRDVKSLSLAQVXLQDXG
TWTCTISQSQQTLEIKIPIVVLAFQKAPETVYVKEGEQAEFSFPLTFEYENLSGELTWQL
ANGDSSSQSWVTFTVKNREVKVNKIPNDPKLLVGEKLPLRLTLPRTLPQHAGSGTLTLDL
TKGKLQQKVNLVVMKVTKSPNSLTCEVLGPSPPKLTLNLKMGNQSMKGSNQPKLVTQPEP
QAGMWQCLLSDNGKVLLEAKIEAPGRTDVSNQEAP
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgggcccggggacctctcttaggcacctgttcttggtgctgcaactggcgatgctccyg
gctggcactcagggaaaaacagtggtgctgggtgaggcaggagacmaggcagagctgccc
tgccaggcttcccagaagaagaacatggtcttcagctggaaagattcttcccagtccaat
attctggggaagcgtggcctcttcttttacaaaggtaccactgaactgagccatcgagtg
gaatccaaaaaaaacctgtgggaccaaggatcctttcctctgatcatcaagaatctccaa
gtaactgactcggggacttatacctgtgaagtggacaagaagacrctcgaggtggaactg
caggtgttcagactgactgccagctcagacacccacgtgctgctgggacagarcctgacc
ttgactttggagagtccctctgggagcaacccttccgtgcaatggaagggtccagggrat
aataataagagagacgtcaagagcctgtcactggcccaggtgrggctgcaggacartggt
acctggacgtgcactatctcccagagccagcagacactggagatcaaaatacccatcgtg
gtgctggccttccagaaggcccccgaaacagtctatgtgaaggagggggagcaggcggag
ttttccttcccactcaccttcgagtatgaaaatctgagcggggagctgacttggcagctg
gcgaacggggattcttcctcccaatcctgggtcaccttcaccgtgaagaacagagaggtg
aaggtgaacaagattcccaacgaccccaagctccttgttggggagaagctaccactgcgt
ctcactctgccacggactttgcctcagcacgcgggttctggaaccctgaccctggatctc
accaaggggaagttgcagcagaaagtgaacctcgtggtgatgaaagtgactaagtcccca
aacagtctgacctgtgaggtgctggggcccagcccgccaaagctgaccctgaacttgaag
atggggaatcagagtatgaagggctcaaatcagccgaagttggtgacacagccggagccc
caggctgggatgtggcagtgtctgctgagtgacaatggcaaagtcctgttggaagccaag
atcgaggcgccgggcagaacggatgtctcaaatcaagaggctccttag

DBGET integrated database retrieval system