KEGG   Bos indicus (zebu cattle): 109559043
Entry
109559043         CDS       T04792                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7 isoform X1
  KO
K06590  integrin beta 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04151  PI3K-Akt signaling pathway
biu04510  Focal adhesion
biu04512  ECM-receptor interaction
biu04514  Cell adhesion molecules
biu04672  Intestinal immune network for IgA production
biu04810  Regulation of actin cytoskeleton
biu05165  Human papillomavirus infection
biu05202  Transcriptional misregulation in cancer
biu05410  Hypertrophic cardiomyopathy
biu05412  Arrhythmogenic right ventricular cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109559043 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109559043 (ITGB7)
   04514 Cell adhesion molecules
    109559043 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109559043 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109559043 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    109559043 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109559043 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109559043 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    109559043 (ITGB7)
   05414 Dilated cardiomyopathy
    109559043 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109559043 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109559043 (ITGB7)
   04515 Cell adhesion molecules [BR:biu04515]
    109559043 (ITGB7)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109559043 (ITGB7)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin beta subunits
   109559043 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 109559043
NCBI-ProteinID: XP_019816026
Position
5
AA seq 800 aa
MVALSMVLVFLLALSRGESELDAKSSSPQEATEWRDPNLSLPGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCLPGELEEPHGRQEVLQDDPLSQGTRGEGA
TQLAPQRVRVTLRPGEPQQLRVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTDSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPSRLESCQPPFSFHHVLSLTGDAE
AFEREVGRQNVSGNLDLPEGGFDAILQAALCQKQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYRELS
NLIPKSAVGELSEDSSNVVQLIMDAYNRLSSTVTLEHEHSLLPPGVRISYESQCGDSEKR
LSEAGDWVQCNQVRINQTVNFWVTFQATHCLPEPHLLRFRARGFSEELTVELHTVCDCNC
SDAQLXAPHCSDGQGHLQCGVCSCVPGRLGRLCECSEAELSSPDLESGCRVPNGTGPLCS
GRGQCQCGRCTCSGQSSGRLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACEC
SGDTDNCVSPDGGFCNGHGHCNCDRCQCDDGYYGALCDQCSGCKTPCETHRDCAECKAFG
TGPLARNCSTACAHANMTLVLTPTLDDSWCKERTQDNQLFFFLAEDEAGGRVVLTVRPPE
EGADHTRIIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREFHRFEKERQHLNWKQDHNPLY
QSAITTTVNPRFQEADSPVL
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggtggctttgtcaatggtccttgttttcctgctggccctgagcagaggtgaaagtgag
ttggacgccaagagctcatccccacaggaggccacagagtggagggatcccaatctgtcc
ctgccagggtcctgccagccagctccctcctgccaaaagtgcatcctctcacacccgagc
tgtgcatggtgcaagcaactgaacttcacagcgtccggggaggcggaggcgcggcgctgt
gctcggcgagaagagctgctggcccggggctgcctcccgggggagctggaggagccccac
ggccggcaggaggtgctgcaggatgacccgctcagccagggcacccgcggcgagggggcc
acccagctggcgccgcagcgggtccgggtcacgctgcggccgggrgagccccagcagctc
cgggtccgcttccttcgagctgagggataccccgtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggagcgcgtgcgacagctcgggcacgcgctgctggtg
cggttgcaggaggtcactgactccgtgcgcattggctttggctccttcgtggacaaaacg
gtgctgcccttcgtgagcacagtgccctccaagcttcgtcacccctgcccctcccggctg
gagagctgccagccacccttcagttttcaccatgtgctgtccctcactggggatgcagag
gccttcgagcgggaggtgggacgccagaacgtgtccggcaacctggacttgcccgaaggt
ggctttgatgccattctgcaggctgccctctgccagaagcagattggctggagaaatgtg
tcccgcctgctggtgttcacgtcagatgacacattccacacagctggggacggcaagctg
ggcggcatcttcatgcccagcgacgggcactgccacttggacagcaatggcctctacagt
cgcagcccagagtttgactacccttctgtgggtcaagtagcccaggccctgtctgcggca
aacattcagcccatctttgctgtcaccagtgccacactacctgtctaccgggagctgagt
aacctgattcccaagtctgcagtgggggagctgagtgaggactccagcaatgtggtgcag
ctcatcatggatgcttataacagactgtcatccactgtgaccctcgaacacgaacactct
cttctccctccgggggtccgcatctcttatgaatctcaatgtggggattctgagaagaga
ctgagtgaagctggcgactgggtacagtgcaaccaagtccgaatcaaccagacggtgaat
ttttgggttactttccaagctacccactgcctcccagagcctcatctgctgaggttccga
gcccgtggcttctctgaggagctgactgtggagttgcacacagtgtgtgactgtaactgc
agcgacgcccagctcmaggctcctcactgcagtgatggccaggggcacctccagtgtggg
gtgtgcagctgtgtccccggccgcctgggtcgactctgtgagtgttcggaggctgagcta
tcctccccagatctggagtctgggtgccgggtccccaacggcacagggcccctgtgcagc
gggaggggacaatgccagtgtggacgctgcacctgcagtggacagagctctggacgcctg
tgcgagtgtgacgatgccagctgtgagcgacatgaaggcatcctctgtggaggctttggc
cgttgccaatgtggagtgtgtcactgtcacgccaaccgcacgggcagagcatgtgaatgc
agtggygacacggacaactgtgtcagtcctgayggagggttctgcaatgggcacggacac
tgcaattgcgaccgctgccagtgcgacgacggctactatggtgccctttgtgaycaatgc
tcaggctgcaagacaccatgcgagacacacagggactgtgcagagtgcaaagcctttggg
actggtcccctggccaggaactgcagcacagcgtgtgcccacgccaacatgactctggtt
ttgacccctaccctggatgacagctggtgtaaagagagaacccaggacaaccagctcttc
ttctttctggcagaggatgaagctggaggcagagttgtgctcacagtgagacctccagag
gagggagcagaccacacccgaatcattgtgctgggctgtgtggggggcatcgtggcggtg
ggactgggattggtcctcgcttatcggctctcggtggagatctatgaccgccgagaattc
catcgttttgaaaaggagcggcagcatctcaactggaagcaggaccacaatcctctctac
caaagcgccatcacgaccactgtcaacccccgctttcaagaggcagacagccccgttctc
tga

DBGET integrated database retrieval system