KEGG   Bos indicus (zebu cattle): 109559214
Entry
109559214         CDS       T04792                                 

Gene name
CNTN1
Definition
(RefSeq) contactin-1 isoform X1
  KO
K06759  contactin 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109559214 (CNTN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:biu04515]
    109559214 (CNTN1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
    109559214 (CNTN1)
Cell adhesion molecules [BR:biu04515]
 Immunoglobulin superfamily
  Contactins
   109559214 (CNTN1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:biu00537]
 Others
  109559214 (CNTN1)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_5 Ig_4 Pur_ac_phosph_N C2-set_2 Big_3_4 Interfer-bind ChitinaseA_N
Other DBs
NCBI-GeneID: 109559214
NCBI-ProteinID: XP_019816344
Position
5
AA seq 1018 aa
MKMWLLFSLLVIISFKTCLSEFTWHRRYGHGVSEEDKGFGPIFEEQPINTIYPEESPEGK
VSLNCRARASPFPVYKWRMNNGDIDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPLPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENNRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYSYHRGELRLYDVTFENAGMYQCIAENTHGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPTFLWSKGTERLVNSSRILIWEDGSLEINNITRSDGG
VYTCFVENNKGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIE
GNMEAARAVDLIPWMEYEFRVVATNTLGIGEPSIPSNKIKTDGAAPNVAPSDVGGGGGSN
RELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMRPSTAF
QVKVKAFNNKGDGPYSLTAVIHSAQDAPSEAPTAVGVKVLSSSEISVHWEHVVEKIVESY
QIRYWASHDKEAAAHRVQVASQEYSARLENLLPDTQYFVEVRACNSAGCGPPSDMIETFT
KKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKH
SIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGASILSPCLLGFLLPALGILVYLEF
NT seq 3057 nt   +upstreamnt  +downstreamnt
atgaaaatgtggttactgttcagtctccttgtaataatatcttttaaaacttgtctatca
gagtttacatggcacagaaggtatggtcatggagtttctgaggaagacaaaggatttgga
ccaatttttgaagaacaaccaatcaataccatttatccagaggagtcaccggaaggaaaa
gtttcactaaactgtagggcacgagccagccctttcccagtttacaaatggagaatgaat
aatggggatattgatctgacaagtgatcggtacagtatggtaggaggaaaccttgttatc
aacaatccggacaaacagaaagatgctggaatatattactgtttagcatcaaataactat
gggatggtcagaagcactgaagcaaccctgagttttggatatcttgatcctttcccacct
gaggaacgtcctgaggtcagagtgaaagaagggaagggaatggtgctactctgtgaccct
ccataccatttcccagatgatcttagctaccgctggcttctaaatgaatttcctgtattt
atcacaatggataaacgaagatttgtgtctcagacaaatggcaatctctacattgctaat
gttgaggcatctgacaaaggcaactattcttgctttgtatccagtccctctattacaaag
agtgtgttcagcaaatttatcccactcattccactacctgaacgaacaacaaaaccatat
cctgctgatattgtagttcagttcaaggatgtatatgcattgatgggccaaaacgtgact
ttagagtgttttgcacttggcaatcctgttcctgatatccgatggcgaaaagtcctagaa
ccaatgccaagcacagctgagatcagcacctctggagctgtcctcaagatcttcaatatt
cagctagaagatgaaggcatatatgaatgcgaggctgagaacaatagaggaaaggataaa
caccaggcaagaatttatgttcaagcatttcctgagtgggtggaacacatcaatgacaca
gaagtggatataggcagtgatctctactggccttgtgtggccacggggaagcccattcct
accatccgatggctgaagaatggatattcgtaccatagaggggaactgaggctgtatgac
gtgacctttgaaaacgctggcatgtaccagtgcatagctgaaaacacacatggagcaatt
tacgcaaatgccgagttgaagatcctggctttggctccaacttttgaaatgaatcctatg
aagaaaaagatcctggctgctaaaggaggacgggttataattgaatgcaaacccaaagct
gcacccaaaccaacatttttatggagtaaaggcacagagcggcttgtcaatagcagcaga
atactcatttgggaagatggtagcttagaaatcaataacattacaaggagtgatggaggt
gtctatacatgctttgtggaaaataataaagggaaggctaatagcactgggactcttgtt
atcacagatcccacacgaattatcttggccccgattaacgctgatatcactgttggagaa
aatgccaccatgcagtgtgccgcttcctttgatcctgccctggatctgacatttgtttgg
tccttcaatggttatgtgatcgactttaacaaagagaacattcattaccagcggaatttt
atgctggattccaatggggagctgctcatccgaaatgcccagttgaaacacgctgggagg
tacacgtgcacagctcagacaattgtagacaattcttcagcctctgctgaccttgttgtg
cgaggccctccaggccctccaggtggtctgcgaatagaagacattagagccacttctgtg
gcacttacttggagccgtggttcagacaatcatagtcctatatctaagtacactatccag
acgaagactattctttcggatgattggaaagatgcgaagacagatcccccaattattgaa
ggaaacatggaggcagcgagagcagtggatttaatcccatggatggaatatgaatttcgt
gtggtagcaaccaatacattgggtataggagagcccagtataccatcaaacaaaattaaa
acagatggcgctgcacctaatgtggctccttcagatgtaggaggtggaggtggaagcaac
agagaactgaccataacatgggcgcctttgtcaagagaataccattacggcaacaatttt
ggttacatagtggcatttaagccatttgatggggaagaatggaaaaaagtgacagttact
aatccagatactggccgctatgtccataaagacgagaccatgcgcccttccactgcattt
caagtcaaagtcaaagctttcaacaacaaaggagacggaccctacagtctcacagctgtc
atccactccgcacaagacgctcccagtgaagccccaacagcagtaggagtaaaagtctta
tcatcttctgagatatctgttcattgggagcatgttgtagaaaaaatagtagaaagctat
cagattcggtactgggcttcccatgacaaagaagcagctgcacacagagttcaagttgct
agccaagaatactcggccaggctggagaaccttctgcctgacacccagtattttgtggaa
gtcagggcgtgcaatagtgcagggtgtggacctcccagtgatatgattgagaccttcacc
aagaaagcacctccaagccagcctccgcggatcatcagttccgtaaggtctggttcacgc
tacataatcacctgggatcatgtggttgcactgtcaaatgaatctacagtgacgggatat
aaggtactctatagacctgatggccagcatgatggcaagctgtattcaactcataaacac
tccatagaagtcccaatccccagggatggagaatatgttgtagaggttcgtgcacacagt
gatggaggagatggagtrgtgtctcaagtcaaaatttcaggtgcatccatcctatcacca
tgtcttctcggcttcctgctgcctgcccttggcatccttgtctacttggaattctga

DBGET integrated database retrieval system