KEGG   Bos indicus (zebu cattle): 109559245
Entry
109559245         CDS       T04792                                 

Gene name
JAM2
Definition
(RefSeq) junctional adhesion molecule B
  KO
K06735  junctional adhesion molecule 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04514  Cell adhesion molecules
biu04530  Tight junction
biu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109559245 (JAM2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109559245 (JAM2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109559245 (JAM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109559245 (JAM2)
CD molecules [BR:biu04090]
 Proteins
  109559245 (JAM2)
SSDB
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Ig_6 C2-set_2 Izumo-Ig Ig_C17orf99 Ig_5 DAG1 DUF3377
Other DBs
NCBI-GeneID: 109559245
NCBI-ProteinID: XP_019816442
Position
1
AA seq 298 aa
MARRSRHHLLLLLLRYLVVALDYHKAYGFSASKDHQVVTAIEYQEAILACKYPKKTVSSR
LEWKKLGRGVSFVYYQQALQGDFKDRAEMIDFSIRIKNVTRNDAGKYRCEVSAPSEQGQN
LEEDTVTLEVLVAPAVPSCEVPNSALRGTVVELRCQDKEGNPAPEYTWFKNGVPLSENPK
LGSQITNSSYTMNPKSGTLQFNTVSKMDSGEYSCEARNSVGHRRCPGKRMQVDDLNISGI
IAAVVIVALVISVCGLGVCYAQRKGYFSKETSFQKSSSASKATTMSENDFKHTKSFII
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcaaggaggagccgccaccacctcctgcttctcctgctgcgctacctggtggtcgcc
ctggactatcataaggcctatggattctctgcctcaaaagatcatcaagtggtcacagca
atagagtatcaagaggctattttagcctgtaaatacccaaagaagaccgtttcctccaga
ttggagtggaagaaattggggcgcggtgtttcctttgtctactatcaacaggctcttcaa
ggtgattttaaggatcgagctgagatgatagatttcagcatacggatcaaaaatgttaca
agaaatgatgccgggaaatatcgttgtgaagttagtgccccatcggaacaaggtcaaaac
ctggaagaggatacggtcactctagaagtattagtggctccggcagttccatcatgtgaa
gtgcccaattctgctctgcgtggaactgtggtagagctgcgatgtcaggacaaagaaggc
aacccagctcctgaatatacatggtttaagaayggygttcctttgtcagagaatccaaaa
cttggctcccaaatcaccaacagctcatacacaatgaatccaaaatctggaactctgcaa
tttaatactgtttcaaaaatggacagtggagaatattcctgcgaagcccgtaattctgtt
ggacatcgcaggtgtcctgggaaacgaatgcaagtagatgatctcaacataagtggcatc
atagcagctgtagtcattgtggccttggtgatttctgtctgtgggcttggcgtgtgctat
gctcagaggaaaggctacttttcaaaagaaacatctttccagaagagtagttctgcatcc
aaagccactaccatgagtgaaaatgatttcaagcacacaaaatcctttataatttaa

DBGET integrated database retrieval system