KEGG   Bos indicus (zebu cattle): 109559326
Entry
109559326         CDS       T04792                                 

Gene name
DDIT3
Definition
(RefSeq) DNA damage-inducible transcript 3 protein
  KO
K04452  DNA damage-inducible transcript 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04141  Protein processing in endoplasmic reticulum
biu04210  Apoptosis
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109559326 (DDIT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559326 (DDIT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109559326 (DDIT3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109559326 (DDIT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559326 (DDIT3)
   05012 Parkinson disease
    109559326 (DDIT3)
   05014 Amyotrophic lateral sclerosis
    109559326 (DDIT3)
   05020 Prion disease
    109559326 (DDIT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109559326 (DDIT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559326 (DDIT3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    109559326 (DDIT3)
SSDB
Motif
Pfam: bZIP_2 GAS bZIP_1 DivIC CLZ DUF5595 Fungal_TACC MAJIN Gcd10p DUF5094 WDCP DASH_Spc19 DUF1003 RR_TM4-6 IFP_35_N Neur_chan_memb
Other DBs
NCBI-GeneID: 109559326
NCBI-ProteinID: XP_019816525
Position
5
AA seq 168 aa
MAAESLPFSFGALSSWELEAWYEDLQEVLSSDENRGTCVSPPGNKEEESKSFTTLDPASL
AWLTEEPGPPEVTHTSQSPCSPESSQSSLAQEEEEEDQGRTRKRKQSGQSPARAGKQRMK
EKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggcagctgagtcactgcctttctccttcggggcactgtccagctgggagctggaagcc
tggtatgaggacctgcaggaggtgctgtcctcagatgaaaatcggggcacctgtgtttca
ccccctggaaacaaggaggaagaatcaaaaagcttcaccactcttgaccccgcctctctg
gcttggcttactgaggagccaggaccaccagaggtcacacacacctcccagagcccctgc
tctccagagtccagtcagagctccctggctcaggaggaagaagaggaagaccaaggaaga
accagaaaacggaaacagagtggccagtccccagctcgggctggcaagcaacgcatgaag
gagaaagaacaagaaaatgaaaggaaagtggcacagctggctgaagagaatgaacgactc
aaacaggaaatcgagcgcctgaccagggaagtggaggcaactcgccgagctctgattgac
cggatggttaatctgcaccaagcatga

DBGET integrated database retrieval system