KEGG   Bos indicus (zebu cattle): 109559397
Entry
109559397         CDS       T04792                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    109559397 (RDH5)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     109559397 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10
Other DBs
NCBI-GeneID: 109559397
NCBI-ProteinID: XP_019816658
UniProt: A0A6P5BTV3
Position
5
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDRQCLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSIRQAVKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWQTREDFQRVLNVNTLGPIGVTLALLPLLLQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLETLEDTLQACWARLPPATQALYGEA
FLTKYLXVQQRIMNMICDPDLAKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAR
LVDAVLAWVLPKPAQTVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgtcttgctctgggcagcactgtggttgctcagggac
cggcagtgcctgccagccagcgatgcttttatcttcatcaccggctgtgactcgggcttt
gggcggctccttgctctgaggctggaccagagaggcttccgagtactggccagctgcctg
acaccctcgggggcggaggacctccagcgggtcgcctcctcccgcctccacaccaccctg
ctggatgtcacagatccccagagcatccggcaggcagtcaagtgggtggaaacgcatgtt
ggggaagcagggctttttggtctggtgaataatgctggtgtggctggcatcattggtccc
accccatggcagacgcgggaggacttccagcgggtgctgaatgtgaacacgctgggtccc
atcggggtcaccctcgccctgctgcccctgctgctgcaggcccggggccgagtgatcaac
atcaccagtgtccttggccgtctggcagccaatggagggggctactgcgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgagatgtggctccttttggggtacgggtc
tctatcgtggaacctggcttcttccgaacccctgtgacaaacctggaaactttggaggac
accctgcaggcctgctgggcacggctgcctccagccacacaggccctctatggggaggcc
ttcctcaccaaatacctgasagtgcagcaacgtatcatgaacatgatctgtgatccggac
ctggccaaggtgagcaggtgcctggagcatgccctaactgcccgtcaccccagaacccgc
tacagcccaggctgggatgccaagctgctctggttgccagcctcctacttgccagccagg
ctggtggatgctgtgctcgcctgggtccttcccaagcctgcccagacagtctactaa

DBGET integrated database retrieval system