KEGG   Bos indicus (zebu cattle): 109559418
Entry
109559418         CDS       T04792                                 

Gene name
APAF1
Definition
(RefSeq) LOW QUALITY PROTEIN: apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05016  Huntington disease
biu05020  Prion disease
biu05134  Legionellosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109559418 (APAF1)
   04215 Apoptosis - multiple species
    109559418 (APAF1)
   04115 p53 signaling pathway
    109559418 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559418 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109559418 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559418 (APAF1)
   05012 Parkinson disease
    109559418 (APAF1)
   05014 Amyotrophic lateral sclerosis
    109559418 (APAF1)
   05016 Huntington disease
    109559418 (APAF1)
   05020 Prion disease
    109559418 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    109559418 (APAF1)
   05152 Tuberculosis
    109559418 (APAF1)
  09172 Infectious disease: viral
   05162 Measles
    109559418 (APAF1)
   05164 Influenza A
    109559418 (APAF1)
   05161 Hepatitis B
    109559418 (APAF1)
   05160 Hepatitis C
    109559418 (APAF1)
   05168 Herpes simplex virus 1 infection
    109559418 (APAF1)
   05169 Epstein-Barr virus infection
    109559418 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109559418 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD WD40_like Ge1_WD40 CARD_2 AAA_16 Hira ATPase_2 AAA_22
Other DBs
NCBI-GeneID: 109559418
NCBI-ProteinID: XP_019816697
Position
5
AA seq 1249 aa
MDAKARNCLLQHREALERDIKTSYIMDHMISNGVLTVSEEEKVKNEPTQRQRAAMLIKMI
LKKDNHSYISFYNALLHEGYKDLAALLHGGIPVXSSSDGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSFLEDCFPG
GVHWVSVGKQDKSGLLMKLQNLCARLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESGLGKEKGLEILSLFVN
MKKADLPEQAHSIIQECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDLETEEVEDILQEFVN
KSLLFCDRNGKSFLYYLHDLQVDFLAEKNRSQLQDLHKKMVTQFQRHHQLYSLSPDQEDC
MYWYSFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDGID
CENFQEFLSLNGHLLGRQPFPNIVQLGLCELETSEVYRQAKLQAKQEVDNGMLYLEWVNK
KNMKNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSADDKFIATCSVDKKVKIWNSMTGELVRIYDEHSEQVNCCHFTNNSNHLLLATGS
NDYFLKLWDLNQEECRNTMFGHXNSVSHCRFSPDDQVLASCSADGTLKLWDVKSANERKS
INVKQFFLNSEEPQEDLEVIVKCCSWSADGAKIMVAAKNKVFLFDIHSSGLLAEMHMGHH
SAVQYCDFSPHNHLAVVALSQYCVELWSMDSGLKVADCRGHLSWVHCVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSATVLKQEIDVVFQENEVTVLAVDNIRRLQLINGNTGQIDYLT
EAQVSCCCLSPHLQYLAFGGEDGAIQILELLNNRIFQSRNGHKTTVRHIQFTADGKTLIS
SSDDSAVQIWNWQSEDPFFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITRRIEKD
FVCHQDTVLSCDISSDATKFSSTSADKTAKIWSFELLSPLHELRGHKGCVRCSSFSVNNX
LLATGDDNGEIRIWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDTKMLVSAGGYL
KWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILKILE
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcarcatagagaagccttggaaagggacatc
aaaacatcctacattatggatcacatgattagtaatggagttttaacagtgtcagaggag
gaaaaagtgaaaaatgagcccacccaacggcaacgagcagctatgctaattaaaatgata
cttaaaaaagataatcattcctatatatcrttctacaatgctctacttcatgaaggttac
aaagatcttgctgcccttctgcatggtggcattcctgtyrtctcttcttccgatggcaaa
gattcagttagtggaataacttcgtaygtaaggacagtcctgtgtgaaggtggagtacca
cagaggcccgttgtttttgttactaggaagaagctagtgaatgcaattcagcagaagctc
tccaaactgaatggtgaaccaggatgggtcaccatatatgggatggcaggttgtgggaag
tctgtattagctgcagaagcygttcgagatcattctttcctagaagattgtttcccagga
ggcgtgcattgggtgtcagttgggaaacaggacaaatccgggcttctgatgaaactacag
aacctttgtgcacgattggatcaggatgagagcttctcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgcattctgatgctgcgcaaacatccaaggtctttattg
atcttggatgatatttgggatccttgggtgttaaaagcttttgacaatcagtgtcaaatt
cttctcacaactagagataagagtgttacagattcagtgatgggtcctaaatatgtagtg
cctgtggagagtggtttaggaaaagaaaaaggacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcacagtattatacaagaatgtaaaggttcc
cctcttgtagtatctttaattggtgcacttttacgagattttcccaaccgctgggagtac
tacctcaggcaacttcagaataagcaatttaagaggataagaaaatcttcatcttatgac
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
gattattacacagatctttccatcttacagaaagatgttaaggtgcctacaaaggtgtta
tgtatcctytgggacttggaaacggaagaagttgaagacatattacaggaatttgttaat
aagtctctcttgttctgtgaccggaatggaaaatcatttctttattatttacatgatctg
caagtagatttccttgctgaaaagaatcgcagccagcttcaggatctccacaagaagatg
gtcactcagttccagagacatcaccagctatattctctttcaccagatcaggaggattgc
atgtattggtacagttttctggcctatcacatggccagtgctaatatgcacaaagaactg
tgtgctttaatgttttccctggattggattaaagcaaaaacggaacttgtaggccctgct
catctgattcatgaatttgtggaatacaggcatatattggatgaaaaggatggtatagac
tgtgagaatttccaggagtttttatctttaaatggacatcttcttggacgacagccattt
cctaatattgtgcaactgggcctctgtgaactggaaacttcagaggtttatcggcaagct
aagctgcaggccaagcaggaggtcgataacggaatgctttacctggagtgggtaaacaaa
aaaaacatgaagaacctctcccgcttggttgtccgcccccatacagatgctgtttaccat
gcttgcttttctgaagatggtcaaagaatagcgtcttgtggagctgataaaactttacag
gtattcaaagctgaaacaggagagaaacttctagaaatcaaggctcatgaggatgaagtg
ctttgctgtgcattctctgcagatgacaaatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaattcaatgactggggaactagtgcgtatctatgatgagcactcagag
caagtcaattgctgccacttcaccaacaayagtaatcaccttctcttagcsactggttca
aatgactacttccttaaactctgggatctgaatcaagaagaatgtcgaaataccatgttt
ggccatnacaattcggtcagtcactgcagattttcaccagatgatcaggttttggccagt
tgttcagctgatggaacattaaagctttgggatgtgaaatctgcaaatgagaggaaaagc
attaatgtgaagcaattcttcctgaattcagaggagcctcaggaggatctggaagtgata
gtraaatgctgttcgtggtctgctgatggtgctaagataatggtggctgcgaaaaataaa
gtctttctttttgacattcactccagtggcctgttggcagaaatgcacatgggccatcat
agcgctgtccagtactgtgacttctccccccacaaccatttggcagtggtggctttgtcc
cagtactgtgtggagttgtggagtatggactcaggtttaaaagtagctgattgcagagga
catttaagttgggtccattgtgtgatgttttctcctgatggatcatcgtttttgacatct
tctgatgaccagacaatcaggctctgggagacaaagaaagtatgtaagaactctgctaca
gtgttaaagcaagaaatagatgttgtgtttcaagaaaatgaagtgacggttcttgcagtt
gacaatataagacgtctgcaactcattaatggaaacacaggtcagattgattacctaact
gaagctcaagtgagttgctgttgtttaagtccacatcttcagtaccttgcattcggaggt
gaagatggagccattcagattttagaactcctgaacaacagaatcttccaatccagaaat
gggcacaagaccactgttcggcacatccagttcacagctgatggaaagactcttatctca
agctctgatgattctgcagttcagatatggaactggcaatcagaggaccctttctttctc
caagcccaccaggaaacagtgaaagacttcagactcttgaaaaattcaagacttctttcc
tggtcatttgatggaacagtaaaggtatggaatattattaccagaagaatagaaaaagat
ttcgtgtgtcaccaggatacagttctttcttgtgatatttcctctgatgctactaagttt
tcttctacctctgctgacaagactgcaaagatttggagttttgaactcctttctcctctt
catgaattgagaggccacaaaggctgtgtgcgctgctcttccttctctgtgaacaatasc
ttgttggcgactggagacgacaatggagaaatcaggatatggaatgtctcaaacggtgag
cttcttcatttgtgtgctccgatttcagtagaagaaggagctgctactcatggaggctgg
gtgaccgacctttgcttttctccagacaccaaaatgcttgtttctgctggaggatatctc
aagtggtggaatgttgtcactggggaatcctcacagaccttctacacaaacggaaccaat
cttaagaaaatacacgtgtcccctgacttcaaaacatatgtgactgttgataatcttggt
attttatatattctaaagattttagagtaa

DBGET integrated database retrieval system