KEGG   Bos indicus (zebu cattle): 109559451Help
Entry
109559451         CDS       T04792                                 

Gene name
PAH
Definition
(RefSeq) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00360  Phenylalanine metabolism
biu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
biu00790  Folate biosynthesis
biu01100  Metabolic pathways
biu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    109559451 (PAH)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109559451 (PAH)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109559451 (PAH)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     109559451 (PAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT ACT_4
Motif
Other DBs
NCBI-GeneID: 109559451
NCBI-ProteinID: XP_019816754
Position
5
AA seq 451 aa AA seqDB search
MSALVLESRALGRKLSDFGQETSYIEGNSDQNAVSLIFSLKEEVGALARVLRLFEENDIN
LTHIESRPSRLRKDEYEFFTNLDQRSVPALANIIKILRHDIGATVHELSRDKKKDTVPWF
PRTIQELDNFANQVLSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTE
EEKKTWGTVFRTLKSLYKTHACYEHNHIFPLLEKYCGFREDNIPQLEEVSQFLQSCTGFR
LRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQ
FSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSDK
PKLLPLELEKTAVQEYTITEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVHYDPYTQRI
EVLDNTQQLKILADSISSEVEILCSALQKLK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctctggtcctggagagccgagccttgggcaggaaactcagcgactttggacag
gaaacgagctatattgaaggcaactctgatcaaaatgctgtatcgctgatcttctcactc
aaagaagaagttggtgcactggccagagtattacgtttatttgaggagaatgatataaac
ctgacccacattgaatcaagaccttcacgtttaaggaaagacgagtatgaatttttcacc
aatctggatcaacgcagcgtgcctgccctggcaaacatcatcaagatcttgagacatgac
attggtgccactgtgcacgagctttcccgggataagaagaaagacacagtgccctggttt
ccaagaaccattcaggaactcgacaactttgccaaccaggttctcagctatggagctgaa
ctggatgcagatcacccgggatttaaagatcctgtataccgagcaagacggaagcaattc
gctgacattgcctacaactatagacatgggcagcccattcctcgagtggaatacacggag
gaagaaaaaaaaacatgggggacggtattcaggaccctgaagtccttgtataagacccat
gcttgctatgagcacaaccacattttcccccttctggaaaagtattgcggcttccgtgaa
gataacattccccagctcgaagaggtttctcagtttctgcagagttgcactggtttccgc
ctccgaccagtcgctggcctgctttcttctcgggatttcttgggtggcctggctttccga
gtcttccactgcactcagtacatcagacatgggtctaagcccatgtatacaccagaaccg
gacatatgccatgagctcttgggacatgtacctttgttttcagatcgcagctttgcccag
ttttcccaggagatcggccttgcctccctgggtgcacctgatgagtacattgaaaaactt
gcaacaatttactggtttactgtggagtttgggctctgcaagcaaggagactccataaag
gcatatggtgctgggctcctgtcatcctttggtgaattacagtattgcctatcagacaag
ccaaagctccttcctctggaactggagaagaccgctgtccaggagtatacgatcacagag
ttccagcctctgtattatgtggctgagagttttaatgatgccaaggagaaagtgaggaac
tttgctgccacaatyccacggcccttctcagttcattatgacccatacactcaacggatt
gaggtcttggacaacacccagcaacttaagattttggctgactccatcagtagtgaagtt
gagatcctttgcagtgccctccagaaattaaagtga

DBGET integrated database retrieval system