KEGG   Bos indicus (zebu cattle): 109559524
Entry
109559524         CDS       T04792                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04210  Apoptosis
biu04630  JAK-STAT signaling pathway
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109559524 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109559524 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109559524 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559524 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109559524 (CSF2RB)
   04090 CD molecules [BR:biu04090]
    109559524 (CSF2RB)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL3 receptor family
   109559524 (CSF2RB)
CD molecules [BR:biu04090]
 Proteins
  109559524 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind fn3 IL4Ra_N EpoR_lig-bind IL2RB_N1 Tissue_fac
Other DBs
NCBI-GeneID: 109559524
NCBI-ProteinID: XP_019816890
Position
5
AA seq 890 aa
MTLTQGLLPLALLXLCWGLSITGAEETVPMQTLRCHNDYTSRIICRWADTQDAQRLVNVT
LYRRPKEDHPQRVSCXLSDDKPWLNSPCPGCVPRKCVIPYRNFVLADFDYFSFRPDQPLV
TELTVNLSQHVQPPTPKDLNITATRESLLLFWSIAHXGFQSHWLSSLEFEVVYKRLQDSW
EDALTIHSKSPQAILELKDLQPSSTYVARVRTRLAPGSGLSGRPSQWSQEVSWNSQPGDE
AQPQNLQCFFDGATLLTCTWEVRSEVTHSVSFTLFYKTGPSAREEECSPVQKETGSPYIQ
HRCQIPVPDPRNYSQYIVSVRPKVEERLIKSSDNIQMAPPTLNVTKGRDGYILHWREEKM
SYSHIACIFQVQYKKEGASWEDTKTEDFQNAHTMSLPPLEPASRYQARVRVKPDPGNYNG
IWSEWSEARSWDTDWVLPMWVLALILVISTLILLPVLHFCGVYGYRLNRKWEEKIPNPSK
SHLFQNGSAGLRMPDSMATLGXGSHPHKGPWGSSCPQLLEGVFPVDCRHSEVSPLTTEDP
KDACDSSSEPDMTLTASDLPTEQPPSPPTGLAAPSSRPESQASGFDFNGPYLGPPHSCSL
PDLMGQQVPPQTGVSRKPQSPGSLEYLCLPAGGQVQLVPLAQVKRQGKAGDGDTKSSPGA
QTSPSLESGVDPAPPEPGLMGVGQDQKDRAPTVLPTGLPEDGTVASGYVTTPDLIFTPPI
GAPSPSQAAPPNLPSDQNPTFHPGLADGPPVASAPQKPEFEGYVELPPATGQFPQSPLAS
PAPPRVSSPVLSPGPHRADVSPTSPTPEGLLVLQQVGDYCFLPGPLSPQSKPTSPGPCPE
IRDLNQVVQAKKPPAQAFPQVPAIQLFKALKQQDYLSLPPWDINRPGQVC
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgacactgacccaggggctgctccccctggctctgctggygctctgctggggactcagc
ataacaggggctgaagagactgtcccgatgcagaccctgcgctgccataatgactacacc
agccgcatcatctgcaggtgggcggacacccaggatgcccagcgactggtcaacgtgacc
ctctaccgcaggcccaaggaggaccatccacagcgagtgtcctgcartcttagtgacgac
aagccctggttaaacagcccttgtcctggctgcgtacccagaaaatgtgttattccttac
cgaaactttgtccttgccgactttgactacttctcattccgaccggaccagcctctggtc
actgagctcaccgttaatctgagtcagcatgtgcagccccccacacccaaggacctcaac
atcactgctaccagggagagtctcctgctgttctggagcatagcccatgasggtttccag
agccactggctgtccagcctggagtttgaggtggtctacaagcggcttcaggactcctgg
gaggatgccctcaccatccactccaagtccccccaggccatcttggagctgaaggacctt
cagcccagcagcacctacgtggcccgagtgcgcaccaggctggccccaggctcggggctc
tcaggacgacccagccagtggagccaggaggtttcctggaactcccagccaggggatgag
gcccagcctcagaacctccagtgcttctttgacggggccaccctgcttacctgcacctgg
gaagtgaggtccgaggtaacccactccgtctccttcaccctcttctacaagacyggcccc
agtgcacgggaggaagaatgctctcccgtgcagaaggagactggcagcccctacatccag
caccgatgccagattcctgtgcctgaccccaggaactacagccagtacatcgtctctgtt
cgaccaaaggtggaagagagacttataaagagctcagacaacatccagatggctccccca
accctcaacgtgaccaagggcagagatggctacatcctgcactggagagaagaaaaaatg
agctactcacacatagcttgcatcttccaggtccagtacaagaaagaaggagcctcatgg
gaggacaccaagacagaggacttccagaatgcccacaccatgtcgctgccacctctggag
cccgccagccggtaccaggccagagtgagagtcaaacccgacccggggaactacaatggg
atctggagcgaatggagtgaagcaaggtcctgggacaccgattgggtgctgcccatgtgg
gtcctagccctcatcctcgtcatcagcaccttaatcctgcttccagtcctgcacttctgt
ggcgtctacgggtacaggctgaaccggaaatgggaggagaaaatccctaaccccagcaag
agccacctgttccagaatgggagcgcyggactccggatgccagacagcatggccaccctg
ggcartgggagccacccacacaaggggccgtggggcagcagttgccctcagctcctggag
ggggtgttccctgtagactgcaggcacagcgaggtgtcacctctcaccacagaggaccct
aaagatgcctgtgactcatcatcagagccggacatgactctgactgcctcggatctcccc
acggagcagccccccagccccccgacagggctggctgccccctcaagcaggcctgagagc
caggcttccggctttgacttcaacggtccctatctggggccgccccacagctgctccctg
cctgacctcatgggccagcaggtgcccccacagacgggggtgagcaggaagccacagtcc
ccggggtccctggagtacctgtgtctgcccgcaggggggcaggtgcagctggtcccgctg
gcccaggtgaagaggcagggcaaggccggggatggggacacaaagtccagcccaggggcc
cagacgagcccttccctggagtcaggggtggaccctgcccctccagagcctgggctgatg
ggggttggtcaagatcagaaggacagggcccccacagttctgcccactggcttgcctgag
gatggcaccgtagcctctggttatgtcaccaccccagatctgatattcaccccacccatc
ggggccccatctccctcccaggctgcccctccaaacctcccctcagaccagaaccccact
ttccatcctggactggctgatgggccccctgtagcctcagccccccagaaaccagagttc
gagggctatgtggagctccctccagccacaggccagtttccccagtcccctctagccagc
cctgcccctcccagagtcagcagccctgtcctgagcccaggcccgcaccgggcagatgtg
tcccccacctcccctacccctgagggtctccttgtcctgcagcaggtgggtgactactgc
ttccttcctggccctctctccccccagagtaagcccacttccccaggaccctgtcctgag
atcagggacctcaaccaggtggtccaggctaagaagcctccggctcaggcctttccccag
gtgcctgccattcagctcttcaaagccctgaaacagcaggactacttgtcactgccccct
tgggacattaacaggcctgggcaggtgtgctga

DBGET integrated database retrieval system