KEGG   Bos indicus (zebu cattle): 109559531
Entry
109559531         CDS       T04792                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04071  Sphingolipid signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04520  Adherens junction
biu04650  Natural killer cell mediated cytotoxicity
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04670  Leukocyte transendothelial migration
biu04810  Regulation of actin cytoskeleton
biu05020  Prion disease
biu05135  Yersinia infection
biu05163  Human cytomegalovirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05231  Choline metabolism in cancer
biu05416  Viral myocarditis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559531 (RAC2)
   04014 Ras signaling pathway
    109559531 (RAC2)
   04015 Rap1 signaling pathway
    109559531 (RAC2)
   04310 Wnt signaling pathway
    109559531 (RAC2)
   04370 VEGF signaling pathway
    109559531 (RAC2)
   04071 Sphingolipid signaling pathway
    109559531 (RAC2)
   04024 cAMP signaling pathway
    109559531 (RAC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109559531 (RAC2)
   04520 Adherens junction
    109559531 (RAC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109559531 (RAC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109559531 (RAC2)
   04662 B cell receptor signaling pathway
    109559531 (RAC2)
   04664 Fc epsilon RI signaling pathway
    109559531 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    109559531 (RAC2)
   04670 Leukocyte transendothelial migration
    109559531 (RAC2)
   04062 Chemokine signaling pathway
    109559531 (RAC2)
  09158 Development and regeneration
   04360 Axon guidance
    109559531 (RAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559531 (RAC2)
   05231 Choline metabolism in cancer
    109559531 (RAC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109559531 (RAC2)
   05212 Pancreatic cancer
    109559531 (RAC2)
  09164 Neurodegenerative disease
   05020 Prion disease
    109559531 (RAC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109559531 (RAC2)
   05416 Viral myocarditis
    109559531 (RAC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109559531 (RAC2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109559531 (RAC2)
   05163 Human cytomegalovirus infection
    109559531 (RAC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:biu04031]
    109559531 (RAC2)
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    109559531 (RAC2)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 109559531
NCBI-ProteinID: XP_019816904
Position
5
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagccgtgggcaagacctgcctgctc
atcagctacaccaccaacgccttccctggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccygtgaacctggggctgtgggacacggccggg
caggaggactatgatcgcctccggccactctcctacccgcagacggacgtcttcctcatc
tgcttctcccttgtcagcccagcctcctatgagaatgtccgggccaagtggttccccgag
gtgcggcatcactgtccgagcacaccgatcatcctggtaggcaccaagytggacctgagg
gacgacaaggacaccatygagaagctgaaggagaagaagctggcgcctatcacctacccg
cagggcctggcactggccaaggagattgactcagtgaaatacctggagtgctcggccctc
acccagcgaggcctgaaaaccgtctttgatgaggcgatccgggccgttctgtgcccgcag
cccacacggccacagaagcgcccctgcagcatcctctag

KEGG   Bos indicus (zebu cattle): 109574290
Entry
109574290         CDS       T04792                                 

Gene name
RAC3
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 3
  KO
K07861  Ras-related C3 botulinum toxin substrate 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04071  Sphingolipid signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04520  Adherens junction
biu04650  Natural killer cell mediated cytotoxicity
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04810  Regulation of actin cytoskeleton
biu05135  Yersinia infection
biu05163  Human cytomegalovirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05231  Choline metabolism in cancer
biu05416  Viral myocarditis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109574290 (RAC3)
   04014 Ras signaling pathway
    109574290 (RAC3)
   04015 Rap1 signaling pathway
    109574290 (RAC3)
   04310 Wnt signaling pathway
    109574290 (RAC3)
   04370 VEGF signaling pathway
    109574290 (RAC3)
   04071 Sphingolipid signaling pathway
    109574290 (RAC3)
   04024 cAMP signaling pathway
    109574290 (RAC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109574290 (RAC3)
   04520 Adherens junction
    109574290 (RAC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109574290 (RAC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109574290 (RAC3)
   04662 B cell receptor signaling pathway
    109574290 (RAC3)
   04664 Fc epsilon RI signaling pathway
    109574290 (RAC3)
   04062 Chemokine signaling pathway
    109574290 (RAC3)
  09158 Development and regeneration
   04360 Axon guidance
    109574290 (RAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109574290 (RAC3)
   05231 Choline metabolism in cancer
    109574290 (RAC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109574290 (RAC3)
   05212 Pancreatic cancer
    109574290 (RAC3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109574290 (RAC3)
   05416 Viral myocarditis
    109574290 (RAC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109574290 (RAC3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109574290 (RAC3)
   05163 Human cytomegalovirus infection
    109574290 (RAC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:biu04031]
    109574290 (RAC3)
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    109574290 (RAC3)
SSDB
Motif
Pfam: Ras Roc Arf
Other DBs
NCBI-GeneID: 109574290
NCBI-ProteinID: XP_019837816
Position
19
AA seq 148 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHH
CPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRG
LKTVFDEAIRAVLCPPPVKKPGKKCTVF
NT seq 447 nt   +upstreamnt  +downstreamnt
atggtggatgggaagccggtcaacctggggctgtgggacaccgccgggcaggaggactac
gaccgcctgcggccactctcctacccccaaactgacgtcttcctgatctgcttctccctg
gtgagcccagcctcctttgagaatgttcgagccaagtggtacccagaggttcggcaccat
tgcccgcacacgcccatcctcctggtgggcaccaagctggaccttcgtgacgataaggac
accatcgagcgactgcgggataagaagctagcacccatcacgtacccccagggcctggcc
atggcccgagagatcggttctgtcaagtacctggagtgctcagccctgacccagcggggc
ctgaagacagtgttcgatgaggccattcgggctgtgctctgcccgccccctgtgaaaaag
ccagggaagaagtgcacsgtcttctag

KEGG   Bos indicus (zebu cattle): 109578192
Entry
109578192         CDS       T04792                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04015  Rap1 signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04071  Sphingolipid signaling pathway
biu04145  Phagosome
biu04151  PI3K-Akt signaling pathway
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04510  Focal adhesion
biu04520  Adherens junction
biu04530  Tight junction
biu04620  Toll-like receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04662  B cell receptor signaling pathway
biu04664  Fc epsilon RI signaling pathway
biu04666  Fc gamma R-mediated phagocytosis
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04810  Regulation of actin cytoskeleton
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04972  Pancreatic secretion
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05100  Bacterial invasion of epithelial cells
biu05132  Salmonella infection
biu05135  Yersinia infection
biu05163  Human cytomegalovirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05205  Proteoglycans in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05231  Choline metabolism in cancer
biu05416  Viral myocarditis
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109578192 (RAC1)
   04014 Ras signaling pathway
    109578192 (RAC1)
   04015 Rap1 signaling pathway
    109578192 (RAC1)
   04310 Wnt signaling pathway
    109578192 (RAC1)
   04370 VEGF signaling pathway
    109578192 (RAC1)
   04071 Sphingolipid signaling pathway
    109578192 (RAC1)
   04024 cAMP signaling pathway
    109578192 (RAC1)
   04151 PI3K-Akt signaling pathway
    109578192 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109578192 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109578192 (RAC1)
   04520 Adherens junction
    109578192 (RAC1)
   04530 Tight junction
    109578192 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109578192 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109578192 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    109578192 (RAC1)
   04662 B cell receptor signaling pathway
    109578192 (RAC1)
   04664 Fc epsilon RI signaling pathway
    109578192 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    109578192 (RAC1)
   04670 Leukocyte transendothelial migration
    109578192 (RAC1)
   04062 Chemokine signaling pathway
    109578192 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    109578192 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109578192 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    109578192 (RAC1)
   04380 Osteoclast differentiation
    109578192 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109578192 (RAC1)
   05205 Proteoglycans in cancer
    109578192 (RAC1)
   05203 Viral carcinogenesis
    109578192 (RAC1)
   05231 Choline metabolism in cancer
    109578192 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109578192 (RAC1)
   05212 Pancreatic cancer
    109578192 (RAC1)
   05211 Renal cell carcinoma
    109578192 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    109578192 (RAC1)
   05020 Prion disease
    109578192 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    109578192 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109578192 (RAC1)
   05416 Viral myocarditis
    109578192 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109578192 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109578192 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109578192 (RAC1)
   05135 Yersinia infection
    109578192 (RAC1)
   05100 Bacterial invasion of epithelial cells
    109578192 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109578192 (RAC1)
   05163 Human cytomegalovirus infection
    109578192 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109578192 (RAC1)
   05169 Epstein-Barr virus infection
    109578192 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109578192 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578192 (RAC1)
   04031 GTP-binding proteins [BR:biu04031]
    109578192 (RAC1)
Membrane trafficking [BR:biu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    109578192 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    109578192 (RAC1)
  Macropinocytosis
   Ras GTPases
    109578192 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    109578192 (RAC1)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109578192 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   109578192 (RAC1)
  Exosomal proteins of colorectal cancer cells
   109578192 (RAC1)
  Exosomal proteins of bladder cancer cells
   109578192 (RAC1)
GTP-binding proteins [BR:biu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    109578192 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 109578192
NCBI-ProteinID: XP_019842745
Position
25
AA seq 194 aa
LRNLTSFFFSCLYRAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDT
AGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLD
LRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLC
PPPVKKRKRKCLLL
NT seq 585 nt   +upstreamnt  +downstreamnt
ctaaggaacttaacatcattttttttttcctgtctctatagagctgtgggtaagacttgc
ctcctgatcagttacactaccaatgcatttcctggagaatatatccccactgtctttgac
aactactctgccaatgtcatggtggatggaaaacccgtgaatctgggcttgtgggacaca
gccggacaagaagattatgaccgattacgccccctgtcctacccgcagacagatgtattc
ttaatttgcttttctctcgtgagtcctgcatcatttgaaaatgttcgtgcaaagtggtac
cctgaagtgcgacaccactgtcccaacacacccatcatcctggtggggacgaaacttgac
ctgagggacgataaagacacgatcgagaagctgaaggagaagaagctgacgcccatcacc
tacccgcagggcttggccatggccaaggagatcggtgcygtcaaatacctggagtgctcg
gcgctcacgcagcggggcctcaagacagtgtttgatgaggcgatccgggctgttctctgc
ccaccccccgtcaagaagcggaagaggaagtgcctgctcttgtga

DBGET integrated database retrieval system