KEGG   Bos indicus (zebu cattle): 109559691
Entry
109559691         CDS       T04792                                 

Definition
(RefSeq) alpha-2-macroglobulin isoform X1
  KO
K03910  alpha-2-macroglobulin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109559691
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109559691
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109559691
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109559691
Peptidases and inhibitors [BR:biu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   109559691
Membrane trafficking [BR:biu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109559691
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109559691
SSDB
Motif
Pfam: TED_complement A2M_BRD A2M A2M_recep MG3 MG4 MG2 SVA Big_1 CarboxypepD_reg PIP49_N
Other DBs
NCBI-GeneID: 109559691
NCBI-ProteinID: XP_019817158
Position
5
AA seq 1510 aa
MGEGRLLXSCLLLLLXIRFATSASDSVEPQYMVLVPSLLHTETPEKGCLLLSHLNETVTV
SASLESVRENRSLFTDVVAEKDLFHCVSFTLPRSPTSQEVMFLTIQVKGPTQEFKKRTTV
LVKNEESLVFVQTDKPIYKPEQTVKFRIVLLDESFHPLNELVPLVYVEDPKGNRIAQWQN
LEVENGLQQLTFPLSSEPFQGSYKVVVQKGSGGTAEHPFTVEEFVLPKFEVQVRMPKIIT
ILEEEVQVSVCGLYTYGKPVPGRVTMNMCRKYRNPSNCYGEESNAVCEKFSGZLNNEGCF
SQQVNTKIFQMKRQEFEMKIEVEAKIQEEGTEVELTGKGATEITTTITKLSFVTVDSNLR
RGIPFTGKVLLVDGKGVPMPNKVIFITANEANHNSNTTTDEHGLAQFSITTTKIKGTSLS
IRVKYKDHSPCYGYQWLSEEHQDAYHSANLVFSXSNSFVYLEPLPRELPCGKTQTVQAHY
VLKGQVLKDLKELVFYYLIMAKGGIVRSGTHTLPVEQGDMQGHFSMSVPVESDIAPVARL
LIYAILPDGEVVGDSARYEVEHCLDNKVGLNFSPGQSFPASQAHLRVTASPQSLCALRAV
DQSVLLMRPEAELSAATVYNLLPVKDLSSFPSSVSQQEEDNEDCISHDNVYINGIMYFPV
SNTNEKDMYSFLQDMGLKAFTNSKIHKPKICPQPEEHRIQHHTLLASPVRAEMGRNRDFV
HFDDTSEPPTETVRKYFPETWIWDLVVVSSSGVHEVEVTVPDTITEWKAGALCLSRDTGL
GLSPTASLRVFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIRVSVQLEASPAFLAVP
EKEQETYCICGNGRQTVSWAVTPKSLGNVNFTVSAEAVESQELCGSEVPVVPEHGRKDTI
IKPLLVEPEGLEKEVIFNSLLCPSVDFVFLGAEDGGQVLRHFPPAAATDTAADAHDPARP
GAKVSESLSLKLPPNVVEESARASFSVLGDILGSAMRNTQNLLQMPYGCGEQNMARFAPN
IYVLDYLNETQQLTAELKSKAILYLNTGYQRQLLYKHFDGSYSTFGEHRGNSEGNTWLTA
FVLKSFAQARGYIFIDEAHITEALTWLAQKQKSNGCFRSTGTLLNNAIKGGVDDEVTLSA
YITIALLEMPLPVTHPVVRNALFCLDSAWKSAKEGSQGSHVYTKALLAYAFALAGNQERR
TEVLTSLYEEAVKEDNTIHWTRPQKPRVLTEDIYQPRAPSAEVEMTAYVILAHVTAQPAP
NPEDLKRATSIVKWISKQQNCQGGFSSTQDTVVALHALSRYGAATFTXARKAAQVTIQSS
GTFSTKFQVENSNRLLLQQVSLPEVPGEYSMSVTGEGCVYLQTSLKYNILPKKDEFPFAL
EVQTLPQTCDGPKAHTSFQISLSVSYIGSRPASNMAIVDVKMVSGFIPLKPTVKMLERSN
VSRTEVSNNHVLIYLDKVTNETLTLTFTVLQDIPVRDLKPAIVKVYDYYETDEFAVAEYS
APCSKDTGNA
NT seq 4533 nt   +upstreamnt  +downstreamnt
atgggggaaggcagacttcttcamtcatgtctcctgctacttctcrtcattcggtttgct
accagcgcctcagattctgtggaaccgcaatacatggtgctggtcccctccctgctccat
acggagacccctgagaagggctgcctccttctgagccacctgaatgagacggtgaccgtc
agcgcctccttggagtccgtcagagagaacaggagcctcttcactgacgtggtggcagag
aaggacttattccactgtgtctccttcactctcccaagatctccaaccagtcaagaggta
atgttccttaccatccaagtgaaaggaccaacccaagaattcaagaagcggaccacagtg
ttggttaaaaacgargagagcctggtctttgtccagacagacaaacccatctataaacca
gagcagacagtgaaatttcgtattgtcttgttggacgaaagctttcaccccctgaatgag
ttggttccactagtatatgttgaggaccccaaaggaaatcgcatcgcacagtggcagaac
ctcgaggtagagaatggcctccagcagttgaccttccccctctcatcagagccctttcag
ggctcctataaggtggtggtacagaagggatcaggtgggactgcagagcaccccttcacc
gtggaggaattcgtgcttcctaagtttgaagtacaagtaagaatgccaaagataatcacc
atcttggaagaagaggtgcaagtgtccgtgtgcggcctatacacttatgggaagcctgtc
ccaggacgtgtgactatgaacatgtgcagaaagtacaggaacccttctaattgttatggt
gaagaatccaatgctgtctgtgagaagttcagtggasagctgaacaatgagggctgcttc
tctcagcaagtaaacaccaagatcttccagatgaagagacaagagtttgaaatgaaaatc
gaagtggaagccaagatccaagaagaaggaacagaggtggaattaactggaaagggggcc
actgaaataacaacaaccatcaccaaactctcatttgtcacagtggactcgaaccttaga
cgaggaattcctttcacggggaaggtgctcctagtggacgggaaaggtgtccccatgcca
aataaagtcatcttcatcacagcaaatgaagccaaccacaactctaacaccaccactgat
gagcacggcctggcacagttctccatcaccaccaccaaaatcaagggcacctccctcagt
atcagggtcaaatacaaggatcacagcccctgttacggctaccagtggctgtcagaagag
catcaagacgcttatcacagtgctaatcttgtgttctcccraagcaacagctttgtctac
ctggagcccttgcctcgtgaactgccctgtggcaaaactcagacagtccaagcacattat
gtgctgaagggacaggtcctaaaggatctaaaggagctcgtgttctattacctgataatg
gcaaaaggaggcattgtccgatctgggactcacacactgcccgtggagcagggagacatg
caaggccatttttccatgtcagtccccgtggagtcagacattgctcctgtcgctaggctg
ctcatctatgccattttacctgayggagaagtggtaggggattctgcaagatatgaagtt
gaacactgtctggacaacaaggtgggtttgaacttcagccccggacaaagtttcccggcc
tcccaggcccaccttcgagtcaccgcttcccctcagtccctctgcgccctccgcgccgtg
gaccaaagtgtgctgctcatgaggcccgaagctgagctctcagcagccacggtttataac
ctgctaccagtcaaggacctcagcagtttcccctcaagtgtaagtcaacaggaggaagac
aatgaagactgcatcagtcatgacaatgtctatatcaatggaatcatgtatttcccagta
tcaaatacaaatgaaaaagatatgtatagcttcctgcaggatatgggcttgaaggcattt
accaactcaaagattcataaacccaagatatgtccacagcctgaagaacatagaatacag
catcacacactattagcttctccagtcagagctgaaatgggaagaaatcgtgattttgtg
cattttgatgatacttcagagcctcccacagagactgtacgaaagtacttccctgagaca
tggatctgggacttggtggttgtaagctcttcaggtgtgcatgaagtagaagtaacagtc
cctgataccatcactgaatggaaggcaggggccctctgcctgtccagagacacyggactt
ggtctctctccgaccgcctctctccgagtcttccagcccttctttgtggagcttacaatg
ccctactctgtgatccgtggagaggccttcacactcaaggccacagtgttaaactacctt
cccaaatgcatccgggtcagtgtgcaactagaagcctctcctgcattcctagctgttcca
gaaaaggaacaagagacttattgcatctgtgggaatggccggcagactgtgtcctgggcg
gtaactccaaagtccttagggaatgtgaatttcacagtgagtgcagaggcagtggagtct
caagagctatgtgggagtgaagtgcctgtggtccctgagcatggaaggaaagacacaatc
atcaagcccctgttggttgaacctgaaggactagagaaggaagtaatattcaactccctg
ctttgtccatcagttgactttgtctttctcggtgccgaagatggaggccaagtactccgc
catttcccacccgccgccgccaccgacactgctgccgacgcccacgaccccgcccgacct
ggtgccaaggtgtctgaatcattatctctgaagctgccaccaaatgtggtggaagaatct
gcccgagcctccttctcagttttaggagacatattaggctctgccatgagaaacacccaa
aatctcctccaaatgccctatggttgtggagaacagaatatggcccgctttgcccctaac
atctatgttctggattatctaaatgagacacagcagctgactgcagagctcaagtccaag
gctatcctctacctcaacactggttaccagagacagctgctctacaagcacttcgatggc
tcttacagcacctttggggagcatcgtggcaacagtgagggcaatacttggctcacggcc
tttgtactgaagagttttgcccaggctcgaggctatatcttcattgatgaagcacatatt
actgaagctctcacctggctggcccaaaagcagaagagcaatggctgtttcaggagtact
gggactctgcttaacaatgccatcaagggtggggtggacgatgaagtgaccctctctgcc
tacatcaccatcgcccttctagagatgcctctccctgttacacaccctgtcgtccgcaat
gccctgttctgcctggactcagcctggaagtcagccaaggaaggatcccaaggcagccac
gtctacaccaaggcactgttggcctatgcctttgccctggcgggtaaccaggaaaggagg
acagaggtactgacgtcactgtatgaggaagccgtgaaggaagataataccatccactgg
acacgacctcagaaacccagggtgctcacggaggacatttaccaacccagggctccgtct
gcggaggtggagatgacggcctacgtgatccttgctcacgtcacggcccagccggccccg
aacccagaggacctcaaacgtgccacgagcatcgtgaagtggatctcaaagcagcagaat
tgccaggggggcttctcctccacccaggacacagtggtagctctccacgccttgtccaga
tacggagcagccactttcaccrgcgctaggaaggctgcacaggtgaccatccagtcttca
gggacattttccacaaaattccaagtggaaaacagcaaccgcctgttactacagcaggtt
tcattgccagaggtgcctggagagtacagcatgtcagtcacaggagaaggatgtgtttac
ctccagacatctttgaaatacaatattctcccgaaaaaagaygagttcccatttgctttg
gaggtgcagactctgccccaaacttgtgatggacccaaagcccacaccagcttccagatc
tcactgagtgtcagttatattggaagccgtccagcctccaatatggcaattgttgacgtg
aagatggtatctggcttcattcccttgaaaccaacagtgaaaatgctagaaagatctaac
gtgagccgaacagaagttagcaacaaccatgttttgatttatctggataaggtgacaaat
gagaccctgaccttgaccttcacagttctgcaagacatcccagtaagggatctgaaacct
gccatagtgaaagtctatgactattatgagacagatgagtttgcagttgctgagtacagt
gctccttgcagcaaagatactggaaatgcttaa

DBGET integrated database retrieval system