KEGG   Bos indicus (zebu cattle): 109559782
Entry
109559782         CDS       T04792                                 

Definition
(RefSeq) BH3-interacting domain death agonist-like isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04071  Sphingolipid signaling pathway
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04650  Natural killer cell mediated cytotoxicity
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109559782
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109559782
   04215 Apoptosis - multiple species
    109559782
   04217 Necroptosis
    109559782
   04115 p53 signaling pathway
    109559782
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109559782
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559782
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559782
   05014 Amyotrophic lateral sclerosis
    109559782
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109559782
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109559782
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109559782
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109559782
   05162 Measles
    109559782
   05164 Influenza A
    109559782
   05161 Hepatitis B
    109559782
   05160 Hepatitis C
    109559782
   05168 Herpes simplex virus 1 infection
    109559782
   05163 Human cytomegalovirus infection
    109559782
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559782
   05169 Epstein-Barr virus infection
    109559782
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109559782
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 109559782
NCBI-ProteinID: XP_019817308
Position
5
AA seq 193 aa
MDLKVSNGPGPGDERTTSLLLLGFLQSCPHSCFQRELEALGHELSGHLFHDDELQTDGNR
CSHFPLAAEAETDSERQEEAVREVARQLAQIGDRLEGSIHPGMVAGLASRFSVRSLSEED
RRQCLAAALEQLMQTCPPDVDHEKTQLLLTMLLAKKIADHSPALLRDVFHTTVTFINQNL
LAYVRNLVRNQMD
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatttgaaggttagcaacggccccggccctggggacgagcgcaccacgagcctgctg
ctgctgggcttcctgcagagctgcccccactcctgcttccagagggagctggaggcgctg
ggtcacgagctgtctgggcacctgttccatgatgacgagctgcagacggacggcaaccgc
tgcagccacttccccttggcagcggaagcggagacagattctgagcgtcaggaggaggca
gtccgcgaagtcgcccggcagctcgcccagattggggacaggctggagggcagcatccac
ccagggatggtggccggcctggcctcacgcttcagtgtcaggagcctgtcggaggaggac
aggaggcagtgcctggcggctgcgctggaacagctcatgcaaacctgccctcctgacgtg
gaccacgagaagacccagctcctgctcaccatgctcttggccaaaaagatagccgaccac
tcgccagccttgctccgagatgtcttccacacaacggtgaccttcatcaaccagaacctc
ctcgcctacgtgaggaacttagtccgaaatcagatggactga

KEGG   Bos indicus (zebu cattle): 109559783
Entry
109559783         CDS       T04792                                 

Definition
(RefSeq) BH3-interacting domain death agonist-like isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04071  Sphingolipid signaling pathway
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04650  Natural killer cell mediated cytotoxicity
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05014  Amyotrophic lateral sclerosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    109559783
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109559783
   04215 Apoptosis - multiple species
    109559783
   04217 Necroptosis
    109559783
   04115 p53 signaling pathway
    109559783
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    109559783
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109559783
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559783
   05014 Amyotrophic lateral sclerosis
    109559783
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109559783
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109559783
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109559783
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109559783
   05162 Measles
    109559783
   05164 Influenza A
    109559783
   05161 Hepatitis B
    109559783
   05160 Hepatitis C
    109559783
   05168 Herpes simplex virus 1 infection
    109559783
   05163 Human cytomegalovirus infection
    109559783
   05167 Kaposi sarcoma-associated herpesvirus infection
    109559783
   05169 Epstein-Barr virus infection
    109559783
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109559783
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 109559783
NCBI-ProteinID: XP_019817312
Position
5
AA seq 193 aa
MDLKVSNGPGPGDERTTSLLLLGFLQSCPHSCFQRELEALGHELSGHLFHDDELQTDGNR
CSHFPLAAEAETDSERQEEAVREVARQLAQIGDRLEGSIRPGMVAGLASRFSVRSLSEED
RRQCLAAALEQLMQTCPPDVDHEKTQLLLTMLLAKKIADHSPALLRDVFHTTVTFINQNL
LAYVRNLVRNQMD
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatttgaaggttagcaacggccccggccctggggacgagcgcaccacgagcctgctg
ctgctgggcttcctgcagagctgcccccactcctgcttccagagggagctggaggcgctg
ggtcacgagctgtctgggcacctgttccatgatgacgagctgcagacggacggcaaccgc
tgcagccacttccccttggcagcggaagcggagacagattctgagcgtcaggaggaggca
gtccgcgaagtcgcccggcagctcgcccagattggggacaggctggagggcagcatccgc
ccagggatggtggccggcctggcctcacgcttcagtgtcaggagcctgtcggaggaggac
aggaggcagtgcctggcggctgcgctggaacagctcatgcaaacctgccctcctgacgtg
gaccacgagaagacccagctcctgctcaccatgctcttggccaaaaagatagccgaccac
tcgccagccttgctccgagatgtcttccacacaacggtgaccttcatcaaccagaacctc
ctcgcctacgtgaggaacttagtccgaaatcagatggactga

DBGET integrated database retrieval system