KEGG   Bos indicus (zebu cattle): 109559832
Entry
109559832         CDS       T04792                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04137  Mitophagy - animal
biu04141  Protein processing in endoplasmic reticulum
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04211  Longevity regulating pathway
biu04261  Adrenergic signaling in cardiomyocytes
biu04668  TNF signaling pathway
biu04720  Long-term potentiation
biu04722  Neurotrophin signaling pathway
biu04725  Cholinergic synapse
biu04728  Dopaminergic synapse
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04915  Estrogen signaling pathway
biu04918  Thyroid hormone synthesis
biu04922  Glucagon signaling pathway
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04932  Non-alcoholic fatty liver disease
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu05010  Alzheimer disease
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05020  Prion disease
biu05030  Cocaine addiction
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
biu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109559832 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109559832 (ATF4)
   04668 TNF signaling pathway
    109559832 (ATF4)
   04022 cGMP-PKG signaling pathway
    109559832 (ATF4)
   04151 PI3K-Akt signaling pathway
    109559832 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109559832 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    109559832 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109559832 (ATF4)
   04922 Glucagon signaling pathway
    109559832 (ATF4)
   04912 GnRH signaling pathway
    109559832 (ATF4)
   04915 Estrogen signaling pathway
    109559832 (ATF4)
   04926 Relaxin signaling pathway
    109559832 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    109559832 (ATF4)
   04918 Thyroid hormone synthesis
    109559832 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    109559832 (ATF4)
   04925 Aldosterone synthesis and secretion
    109559832 (ATF4)
   04927 Cortisol synthesis and secretion
    109559832 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109559832 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    109559832 (ATF4)
   04728 Dopaminergic synapse
    109559832 (ATF4)
   04720 Long-term potentiation
    109559832 (ATF4)
   04722 Neurotrophin signaling pathway
    109559832 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    109559832 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109559832 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    109559832 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109559832 (ATF4)
   05012 Parkinson disease
    109559832 (ATF4)
   05014 Amyotrophic lateral sclerosis
    109559832 (ATF4)
   05020 Prion disease
    109559832 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    109559832 (ATF4)
   05031 Amphetamine addiction
    109559832 (ATF4)
   05034 Alcoholism
    109559832 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109559832 (ATF4)
   04934 Cushing syndrome
    109559832 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109559832 (ATF4)
   05161 Hepatitis B
    109559832 (ATF4)
   05163 Human cytomegalovirus infection
    109559832 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109559832 (ATF4)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    109559832 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF3450 DUF4407 Fez1 AAA_13 Nop53 bZIP_Maf DUF4795
Other DBs
NCBI-GeneID: 109559832
NCBI-ProteinID: XP_019817396
UniProt: A0A385KKP9
Position
5
AA seq 348 aa
MAEMSFLSSEVLGGDFVSPFDQLGLGAEESLGLLDDNLEVAKHFKHHGFSCDKAKAGSSE
WLAVDWLVSDNSKEDAFSGTDWMVEKMDLKEFDFDILFSKDDLETMPDELLATLDDTCDL
FQPLVQETNKEPPQIVNPIGHLPEGLPTIDQGAPFTFFQPLPPSPGTLSSTPDHSFSLEL
CSEVVIPEGDSKPDSTTTGFPQCIKEEDAPSDNDSGICMSPDSSLGSPQDSPSTSRGSPN
KSLLSPGALSGSSRPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQ
EALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKAREKKRVL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggccgagatgagctttctgagcagcgaggtgttagggggggacttcgtgtcccccttc
gaccagttgggtttgggggctgaagagagcctaggtctcctagatgacaacctggaggtg
gccaagcacttcaaacatcatgggttctcctgcgacaaggctaaggcaggctcctccgaa
tggctggctgtggattggttggtctcagacaacagcaaggaggatgctttctccgggaca
gattggatggtggagaaaatggatttgaaggagtttgattttgatatcctgttcagtaaa
gatgacctggaaaccatgccagatgagctcttggccacgttggatgacacgtgtgatctc
tttcagcccctagtccaggagactaacaaggagcccccccagatagtaaacccaattggc
catcttccagaaggtttaccaacaattgaccagggtgcccccttcactttctttcaacct
cttcccccttccccagggaccctgtcttccactccagatcattcctttagtttagagcta
tgcagtgaagtggttatccctgaaggagatagcaagccagactccaccactactgggttt
cctcaatgcataaaagaggaggatgccccctcagataatgatagtggcatctgtatgagc
cctgactcctctctgggctctccccaggatagcccttccacctccaggggctctccaaat
aagagcctgctatctccaggtgccctcagtggctcttcccgccccaaaccctacgaccct
cctggagagaagatggtagcagcaaaagtcaagggtgagaagctagacaagaagctgaag
aaaatggagcagaacaagacagcagctactaggtaccgccagaagaagagggcggaacag
gaggccctcactggtgaatgtaaagagctagaaaaaaagaatgaggctctgaaagagaag
gcagattccttggccaaggagatccagtatcttaaagatctgatagaagaggttcgcaaa
gcaagggagaagaaaagggtcctctag

DBGET integrated database retrieval system