KEGG   Bos indicus (zebu cattle): 109560254
Entry
109560254         CDS       T04792                                 

Gene name
CFI
Definition
(RefSeq) complement factor I
  KO
K01333  complement factor I [EC:3.4.21.45]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04610  Complement and coagulation cascades
biu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109560254 (CFI)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    109560254 (CFI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109560254 (CFI)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109560254 (CFI)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.45  complement factor I
     109560254 (CFI)
Peptidases and inhibitors [BR:biu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109560254 (CFI)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109560254 (CFI)
SSDB
Motif
Pfam: Trypsin Ldl_recept_a SRCR Trypsin_2
Other DBs
NCBI-GeneID: 109560254
NCBI-ProteinID: XP_019817875
Position
6
AA seq 618 aa
MKXGHVILLLLCFYLSFCEDNFRKRGKSKAVKKSEAHHAPEASLSKETEASSEVKPTSTQ
DTSQXDFVDKKCLTEKHTHLSCNKVFCQPWQKCIDGTCLCKLPYQCPKNGTRVCSTNGKS
YSTYCQQKSFECYRPEAKFLKSGACTGGGQFSVSLSNGKQDSEGIVAVKLADLDTKMFVC
GDSWSITEANVACIDRGFQLGALDTHRRDPDPNSAECLHVRCRGLETSLAECTFTKGVHN
SEGLAGVVCYTESAAPPKKDSFQCVNGKRIPQKKACDGVNDCVDKSDELCCKDCRGEGFL
CKSGVCIPKQYKCNGELDCITGEDEVGCEETGHPEIKEAAEMLTADMDAERKFTKSFLPK
LSCGVKNNMHIRRKRVVGGKPAKMGEFPWQMAIKEGDKIHCGGIYIGGCWILTAAHCVRI
SRMHRYQIWTSFTDWLRPGFQTVVHSVNRIIIHENYNGTTYQNDIALIEMKKRPNEKECV
LSKSIPACVPWSPYLFQPNDKCIVSGWGREKDNQKVYSLRWGEVHLINNCSEFYPGRYFE
KEMQCAGTDDGSIDACKGDSGGPLVCQDVNNVTYVWGVVSWGENCGKSEFPGVYTKVANY
FDWISQHVGRSLISQHNI
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgaagyttggtcatgtcattctcttacttttgtgcttctacttaagtttttgtgaggat
aattttagaaaacgaggaaagtcaaaggcagtgaagaaatcagaggctcaccatgcccct
gaagcaagtctgagcaaggagacagaagcttcatctgaagtgaagcccacttcaacacaa
gacacatctcaaaamgatttcgtggataaaaagtgcttaactgaaaaacacacacatctc
tcctgcaacaaagtcttctgccaaccrtggcagaaatgcatcgatgggacgtgtctttgt
aaacttccttatcagtgcccgaagaatggtaccagggtgtgttcaactaatgggaaaagc
tactcaacttactgtcagcagaagagttttgaatgttatcgtcctgaggcaaagtttttr
aaaagtggagcatgcacaggtggagggcaatttagtgtttccttgtcaaatggaaaacaa
gattcagaaggaattgttgctgtaaaacttgcagacctagatacaaaaatgtttgtgtgt
ggagacagctggagcattactgaggccaacgtggcctgcattgaccgtggatttcaactg
ggtgctcttgatactcatagaagagatcctgatccaaattctgctgaatgtctgcatgtg
cgttgtcgaggattagagaccagtttggctgaatgtactttcactaagggagtacacaat
tcggaggggttggctggtgtggtgtgttacacagagagtgcagctcctccaaaaaaggac
tcctttcaatgtgtgaatgggaaacgcattcctcagaagaaggcctgtgatggtgtcaat
gactgtgtagacaagagtgatgagctgtgctgtaaagactgccgaggtgaaggttttctc
tgtaaatcgggtgtttgtattccaaagcagtataagtgcaatggtgagctggactgtatc
acgggagaagatgaagttggttgtgaagaaactggacaccctgaaattaaagaagcagca
gaaatgttgactgctgatatggatgcagaaagaaaatttacaaagtcatttttgcctaaa
ctatcctgtggagttaaaaacaacatgcacattcgaaggaaacgagtcgtaggaggcaag
ccagcaaaaatgggagaattcccgtggcagatggcaatcaaggaaggagacaaaatccac
tgtgggggaatttacatcggtggctgttggattctgactgctgcccattgtgtcagaatc
agcagaatgcatcgttaccaaatatggacatcatttacagactggttaagacctggcttt
cagacggttgttcactcggtgaatcgaattattatccatgaaaactacaatggaactacc
taccaaaacgacatagctttgattgaaatgaaaaaacgcccaaacgaaaaagaatgtgtg
ttgagtaaatccatcccygcctgtgtcccctggtctccgtacctatttcaacctaatgat
aagtgcatcgtttctggctgggggcgagaaaaagataaccaaaaagtatattcacttagg
tggggtgaagttcatctaataaacaactgctcagagttctacccaggtcgctactttgaa
aaagagatgcagtgtgcaggtacagatgatggttctattgatgcrtgtaaaggggactct
ggaggccccttagtstgtcaggatgtcaacaacgtgacttacgtttggggtgttgtgagt
tggggtgaaaactgcggaaaatcagagttcccaggcgtttacaccaaagtggccaattat
tttgactggattagtcaacatgtaggaaggtctcttatttctcagcacaacatataa

DBGET integrated database retrieval system