KEGG   Bos indicus (zebu cattle): 109560653
Entry
109560653         CDS       T04792                                 

Gene name
PTPN13
Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein phosphatase non-receptor type 13
  KO
K02374  tyrosine-protein phosphatase non-receptor type 13
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109560653 (PTPN13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109560653 (PTPN13)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    109560653 (PTPN13)
SSDB
Motif
Pfam: PDZ PTN13_u3 Y_phosphatase PDZ_6 FERM_M PDZ_2 FERM_C FERM_N KIND DSPc PTPlike_phytase
Other DBs
NCBI-GeneID: 109560653
NCBI-ProteinID: XP_019818617
Position
6
AA seq 2484 aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSIADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQSQSLTSLSDVEKIHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVVYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGSL
SGTDQLSRSSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDTYKSPFCHQAFLNKGLSKS
MGFLSIKDTRDEEDYFKDLSSDNNSGQEDSENSCSPYXFKSSGPEKKAVPGLDVLPKKKI
WASSMDLLCTGDRDFSSGETDRYQRRLPEAVTVRTSTTPRKKEARYSDGSLALDIFGPQK
MDPAFHTRDLPTSSAISSALDRIRERQKKLQVLREAMNVEEPVQRYKTYHSDLFSTSSES
PSIISSESDFRQVRKSETSKRFESNSGLPGVDETPSQGQSQRPRQYETPLEGNLINQEIM
LKRQEEEMMQLQARMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFF
GPEFVKMTIEPFISLDLPRSILTKKGKSEDNRRKVNIMLLSGQRLELTCDTKTICKDVFD
MVVAHIGLVEHHLFALATLKDNEYFFVDSDLKLTKVAPEGWKEEPKKKSKASINFTLFFR
IKFFMDDVSLIQHTLTCHQYYLQLRKDILEERIHCDDETSLLLASLALQAEYGDYQPEVH
GVSYFRLEHYLPPRVMEKLDLSYIKEELPKLHNTYMGASEKETELEFLKVCQRLTEYGVH
FHRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTS
DGIKHAFQTDNSKICQYLLHLCSSQHKFQLQMRARQSNQDAQDIERASFRSLNFQAESVR
GFNMGRAVSTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLCQPLQNSAKEKNGKTAW
EEKPRGMSKSYHDLSQACLYPHRKNVNVNMEPPPQTIAELVGKTLHQMARSDTESLAGVT
KLNNSKSVASLNRSPERRKHESDSSSFEDLGQAYVLGMTLHSSGNSSSQVPLKENDVLHK
RWSIASSPEREITLVNLKKDAQYGLGFQIIGGEKMGRLDLGVFISSVTPGGPADLDGCLK
PGDRLISVNSVSLEGVSHHAAVEILQNAPEDVTLVISQPKEKLSKVPSTPVHMANGTKNY
MKKPSHLQDGTVNSSEDHCWPRGTPRHISESSFGLSGGLREGSLSSQDSRTESASLSQSQ
VNGFFASHAADRSWQDSQRGSPSPSVISKATEKKWTSTDSNRSKAKXTGISDAPDYSDRG
DSDMDEATYSSSQDHHIPKKESSSSMNTSNKMNFKTFPSSPPKPGDIFEVELAKNDNSLG
ISVTGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLR
NTGQVVHLLLEKGQSPASKEHVLQCTVSDPDTQGQAPEKMMTKMTHVKDYSFVTEENTFE
VKLLKNSSGLGFSFSREDNVIPEQMNTSIVRVKKLFPGQPAAESGQIDVGDVILKVNGAS
LKGLSQQEVISALRGTSPEVSLLLCRPPPGVLPEIDPALSTPLHSPAQVPLNNSKDPPQT
ACAEQGTSSDENEMSDKNRRPCTSPSRRDSYSDSSESGEDDLAKAPAKIPNMSWSSALQQ
TLSNMMSQAQSHHDTLRSQEDPICTMFYYPQKVPNKPEHEGSNPLPPRPLDVTPGQSCQS
QSESVPINAMDKYHTHHTSEPTRQESLTSLKNDLENHLEDFELEVELLITLHKSEKGSLG
FTVTKGNQSIGCYVHDVIQDPAKSDGRLRPGDRLIKVNDTDVTNMTHTDAVNLLRAAPRT
VRLVLGRVLELPRMPVLPHLLPDITFTCNREELGFSLSGGRDSLHQVVYVSDINPRSIAA
TEGNLQLLDVIHYVNGVSTQGMTLEEAKRTLDMSLPSVVLKATRDGHPVVPSSKGSALSA
SKSAKANGPHIVEPCGKPSLTPNNSFSKVNGEKSLKFVPEGKCSTYQMKESANXILYKES
DGQEDENYDDPQEAEVIQSLLDVVDEEAQNLLNQNNXAGDACVPGALKANEKLSEERAQD
TYCDGSPLPEDFTESTKMNGCEEHCEEKGKSESLIQKSEEKKTEDDEITWGSDELPIETT
DHEDSNKEHPFLTNEELTTLPIIKVLPSGKYTGAKLKSVIRMLRGLLDQGIPSKELENLQ
ELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGREEFVYIA
CQGPLPTTVGDFWQMIWEQNSSVIAMMTQEVEGEKIKCQRYWPNVLGKSTMVSNRLRLAL
VRVQQLKGFVVRAMTLEDIQTGEVRHVSHLNFTAWPDHDTPSQPDDLLTFISYMRHVHRS
GPIITHCSAGIGRSGTLICIDVVLGLISQDLEFDISDLVRCMRLQRHGMVQTEDQYIFCY
QVILYVLTRLQAEEEQKEQPQPLK
NT seq 7455 nt   +upstreamnt  +downstreamnt
atgcacgtgtcactagctgaggccctggaagttcggggtggaccactgcaggaggaagaa
atatgggctgtattaaatcaaagtgccgaaagcctccaagaactattcagaaaagtaagc
atagctgaccctgctgctcttggcttcatcatttctccatggtctctgctgctgctgcca
tccggcagtgtgtcatttacagatgaaaatatttccaatcaggatcttcgtgcattcact
gcaccagaggttcttcagagtcagtcactcacttctctctccgatgttgaaaagatccat
atttattctctcggaatgacaytgtactggggagctgatcatgaagtgcctcagagccaa
cctatcaagcttggagatcatctcaacagcatcctacttggaatgtgcgaggatgtggtt
tatgctcgggtctctgtccggactgtcctggatgcttgcagtgcccacatcaggaatagc
aattgtgcgccttcattttcctaygtgaagcagttggtaaaactggttctgggaagtctt
tctgggacggatcagctttcccgtagcagcgagcaaaagcctgatcgaagccaggctatc
cgagaccgattgagaggaaaaggattaccaacaggaagaagctctacttctgatgttcta
gacacatacaagtctccattctgtcatcaggcctttcttaacaaagggcttagtaaatcc
atgggatttctatctatcaaagatacacgagatgaggaagattatttcaaggacctttca
tcagataataactctggacaagaagattcggaaaattcctgctccccttaccygttcaaa
tctagtggcccagaaaaaaaagctgtccctggcctcgacgtgcttcccaagaagaagatc
tgggcttcgtccatggacttgctttgtacaggtgacagagacttctcttctggggagact
gacagataccaacgccgtctccctgaggcggtyacagtgcggacttcaaccactcctaga
aaaaaggaggcaagatactcagatggaagcctagccttggatatcttcgggcctcagaaa
atggatccagcatttcacacacgagacttgcccacctcctcggcaatatcaagtgctttg
gaccgaatccgagaaagacaaaagaaacttcaggttctgagagaagccatgaatgtagaa
gaaccagttcaaagatacaaaacttaccacagtgatctctttagtacatccagtgaaagt
ccatctattatttcctctgaatcagatttcaggcaagtgagaaaaagtgaaacttcaaag
agatttgaatccaacagtggtctcccaggcgtagatgaaaccccaagtcaaggccagtca
cagagaccaagacaatatgaaacacctcttgaaggcaacttaattaatcaagagatcatg
ctaaaacggcaagaagaagaaatgatgcagctgcaagccagaatggcccttagacagtct
cgattgagcctgtatccaggggacaccatcaaagcttccatgcttgatatcaccagggat
cccttaagagaaatagctctagaaacagccatgacccaaaggaaactaagaaatttcttt
ggtccagagtttgtgaaaatgacgattgaaccatttatatctttggatttgccacggtct
atccttaccaagaaagggaagagtgaagataaccgaagaaaagttaacataatgcttctg
agtggacagagactggaactgacttgtgataccaaaacaatatgtaaagatgtgtttgat
atggtggtggcccatattggcttagtggaacatcatttgtttgccttagctactctcaaa
gataatgagtatttctttgttgattctgatctaaaattaaccaaagtggccccagaggga
tggaaagaagaaccaaagaaaaagagcaaagcctccattaactttactttgtttttccga
attaaatttttcatggatgatgttagtctgatacaacacactctgacctgtcatcagtat
tatcttcagctgcgaaaagacatcttggaggagaggatacattgtgatgatgagacttct
ttattgctagcttccttggctctccaagctgagtatggggattatcaaccggaggttcat
ggtgtgtcatattttagactggaacattacttgcctccaagagtgatggagaaacttgat
ttgtcctatattaaagaagaactacccaaattgcacaatacctacatgggagcttctgaa
aaagagacagagttagaatttttaaaggtctgccaaagactgacagaatacggagttcat
ttccaccgggtgcaccccgagaaaaagtcacaaacgggaatactgcttggagtctgttct
aaaggtgtcctcgtgttcgaggttcacaatggagttcgcacactggtccttcgctttcca
tggcgggaaaccaagaagatttctttttctaaaaagaaaatcacattgcagaatacttca
gatggaataaaacatgccttccagacagacaacagtaagatatgccagtacctgctgcat
ctctgctcttcccagcataagttccagctgcaaatgagagcaagacagagcaaccaagat
gcccaggatattgagagagcttcgtttaggagcctgaacttccaagcagagtccgttaga
ggatttaatatgggacgagcagtcagcactggtagtctggccagcagcaccctgaacaaa
cttgccgttcgacctctgtcggttcaagctgagattctgaagaggctctcctgctcagag
ctgtcgctttgccagccattgcaaaacagtgcaaaagagaagaatggcaaaactgcatgg
gaggaaaagcctagagggatgagtaaatcataccacgatctcagtcaggcctgtctctac
cctcaccggaaaaatgtcaatgttaacatggagcccccaccacaaaccattgcggagttg
gtaggaaaaacgcttcaccagatggcaagatctgatacagaatctctggcaggagtcaca
aaactcaataattcaaagtctgttgcgagtttaaatagaagtcctgaaaggaggaaacat
gaatcagactcctcatcctttgaagaccttggtcaagcatatgttctaggaatgactttg
catagttctggaaattcttcatcccaagtacccttaaaagaaaatgatgtgctacacaaa
agatggagcatagcatcttcaccagaaagggagatcactctggttaacctgaaaaaagat
gcacagtatggcttaggatttcaaattattggtggagaaaagatgggaagactggatcta
ggtgtatttattagttcagttactcctggaggaccagctgacttggatggatgcttaaag
ccaggagaccgtttgatatctgtgaatagtgtcagtctggagggggtcagccaccatgcc
gcagttgaaattttgcaaaatgcacctgaagatgtgaccctggttatctctcagccaaaa
gaaaagctatccaaagtgccttctactcctgtgcacatggccaacggcacgaaaaactac
atgaaaaagccttcccacctgcaagacggcactgtaaattcttctgaggaccactgctgg
ccacggggcaccccgaggcacatctcagagagctcgtttgggctgtctgggggcctgcgg
gagggcagcctgagctctcaagattccaggactgagagtgccagcttgtcacagagccag
gtcaacgggttctttgccagccatgcagctgaccgcagctggcaggactcacagcgtggc
agcccttccccatctgtgatatccaaagccaccgagaaaaagtggacttctactgatagt
aaccgaagcaaagctaaaamtacaggcatttctgatgcaccagattactctgaccgtgga
gattcagacatggatgaagccacttattccagcagtcaggatcatcacataccaaaaaag
gaatcttcctcctccatgaatacatccaacaaaatgaattttaaaacttttccttcatca
cctcctaaacctggagatatctttgaggttgaactggctaaaaatgataacagcttgggg
ataagtgtcacgggaggtgtgaataccagtgtcagacatggtggcatttatgtgaaagcc
gttattcccaagggagcagcagagtctgatggcagaattcacaaaggtgatcgtgtcctc
gctgtcaatggagttagtctagaaggggctacccacaagcaagctgtggaaacactgaga
aatacaggacaggtggttcatctgttgttagaaaaaggacagtctccagcatccaaagaa
catgtcctccagtgtacggtctctgatccagacacccaaggtcaagccccagaaaaaatg
atgacgaaaatgactcatgtcaaagactacagctttgttaccgaagagaatacatttgag
gtgaaattgctgaaaaatagctcaggcctaggattcagtttttctcgagaggataatgtt
atacccgagcaaatgaacaccagcatagtaagggttaaaaagctctttcctggacagccg
gctgcagaaagtggacaaattgatgtgggagatgttatcttaaaagtgaatggagcctct
ttgaaaggattgtctcaacaggaggtcatatccgctctcaggggaacgtctccagaagta
tccttgctcctctgtagacctccacctggggtgctaccagaaattgaccctgctctttcg
acccccttgcactctccagcacaagtacctctgaacaacagcaaagaccctcctcagaca
gcgtgtgcrgagcaaggcaccagctcagatgaaaatgagatgtctgacaaaaacagaaga
ccatgcacgtccccatccaggagagatagttacagtgatagcagtgagagtggagaagat
gacttagcgaaagctccagcaaagataccaaacatgagctggagctcagctttgcaacag
actctaagcaacatgatgtcacaggcacaaagtcatcacgacacactcaggagtcaagaa
gatcccatttgtaccatgttttactatcctcagaaagtacctaataagccagaacatgag
ggcagtaaccctcttccccctcgaccactggatgtaactcctgggcagagctgtcaatct
caatcagaatctgttcccataaatgcaatggataaatatcatacacatcacacttctgaa
ccaactagacaagaaagcttaacatctttgaaaaatgacttggaaaaccaccttgaagac
tttgaactggaggtggaactcctgattaccctacataagtcggaaaaaggaagcctgggc
ttcacagtaaccaaaggcaatcagagcattggttgttacgtgcacgacgtcattcaggat
ccagccaaaagtgatgggaggctgagacctggggaccggctcatcaaggttaatgacaca
gatgttacaaacatgactcacacagatgcagtgaacctactccgagctgcgcccaggaca
gtcagattagttcttggccgagttctggaattacccaggatgccggtgctgcctcatttg
ctacctgatatcacatttacgtgcaacagagaggagttgggtttttccttatctggaggt
cgtgacagccttcatcaagtggtgtatgttagtgatatcaatccgaggtcaatcgcagcc
acagagggtaatctccagctcttagacgtcatccactatgtgaacggagtcagcacacaa
ggaatgactctggaggaagctaagagaacattagacatgtcacttccttcagtggtgctg
aaagctacaagagatggtcatccagtggttcccagttccaaggggtctgctctttcagct
tcaaagtcagccaaagccaatggtcctcacattgtggagccttgtggcaaaccttcgctc
acacctaataactcgttctccaaggttaatggagagaaatcattgaaatttgtacctgaa
ggaaaatgttctacttatcagatgaaggaatcagcaaacntgattctgtacaaagaatct
gatggacaagaagatgagaactacgatgatcctcaagaagctgaagttatccagtctttg
ctggatgttgtggatgaggaagctcagaatcttttaaaccaaaataatgyagcaggagat
gcctgtgttccaggtgcattgaaagccaatgagaagttatctgaagagagagcacaagat
acatactgtgatggttcacctttacctgaagattttacagagtctaccaaaatgaatggc
tgtgaagaacattgtgaagaaaaaggtaaaagtgaaagcttaattcaaaagtcagaagaa
aagaagactgaggatgatgaaataacatggggaagtgatgaattgccaatagaaacaaca
gaccaygaagattccaataaagagcatccctttctgacaaatgaggaactcaccacactc
cccatcatcaaagtgcttccctccgggaartacactggtgccaagctgaagtcagtcatt
cggatgttgcggggtttactcgatcaaggaatcccatctaaggagctggagaatcttcaa
gaattaaaacctttggatcaatgtctaattggacagacgaaggaaaacagaaggaagaac
cgatataaaaatatactgccctatgacgctaccagagtgcctcttggagatgaaggtgga
tatatcaacgccagcttcatcaagataccagtggggagagaagagtttgtgtacatcgcc
tgccaaggacctctccccacaactgttggagatttctggcagatgatttgggaacaaaac
tcctcagtgatagccatgatgacccaagaagtagaaggggaaaaaatcaaatgccagcgc
tattggcctaatgtcctaggcaaatcaaccatggtcagcaacagacttcgactggctctc
gtgagagtgcagcagctgaagggctttgtagtaagggcaatgaccctggaagatattcag
accggagaggtacgacatgtttctcatctgaatttcactgcttggccagaccacgataca
ccttcccagccagacgacttgttgacatttatctcctatatgagacatgttcacagatcg
gggccaatcatcacacactgcagtgcgggcattggacgttcagggaccctaatatgcata
gatgtggttcttggattaatcagtcaagatcttgaattcgacatctccgatttagtgcgc
tgcatgagactacagagacacggaatggttcagacagaggatcaatatattttctgctat
caagtcatcctttatgtcctgacacgtcttcaagctgaagaagagcaaaaagagcagccc
cagcctctgaaatga

DBGET integrated database retrieval system