KEGG   Bos indicus (zebu cattle): 109560786
Entry
109560786         CDS       T04792                                 

Gene name
ITGB2
Definition
(RefSeq) integrin beta-2
  KO
K06464  integrin beta 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04015  Rap1 signaling pathway
biu04145  Phagosome
biu04390  Hippo signaling pathway
biu04514  Cell adhesion molecules
biu04610  Complement and coagulation cascades
biu04650  Natural killer cell mediated cytotoxicity
biu04670  Leukocyte transendothelial migration
biu04810  Regulation of actin cytoskeleton
biu05133  Pertussis
biu05134  Legionellosis
biu05140  Leishmaniasis
biu05144  Malaria
biu05146  Amoebiasis
biu05150  Staphylococcus aureus infection
biu05152  Tuberculosis
biu05166  Human T-cell leukemia virus 1 infection
biu05323  Rheumatoid arthritis
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109560786 (ITGB2)
   04390 Hippo signaling pathway
    109560786 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    109560786 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    109560786 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109560786 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    109560786 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    109560786 (ITGB2)
   04670 Leukocyte transendothelial migration
    109560786 (ITGB2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109560786 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109560786 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109560786 (ITGB2)
   05134 Legionellosis
    109560786 (ITGB2)
   05150 Staphylococcus aureus infection
    109560786 (ITGB2)
   05152 Tuberculosis
    109560786 (ITGB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109560786 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109560786 (ITGB2)
   05144 Malaria
    109560786 (ITGB2)
   05140 Leishmaniasis
    109560786 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109560786 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109560786 (ITGB2)
   04515 Cell adhesion molecules [BR:biu04515]
    109560786 (ITGB2)
   04090 CD molecules [BR:biu04090]
    109560786 (ITGB2)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    109560786 (ITGB2)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109560786 (ITGB2)
Cell adhesion molecules [BR:biu04515]
 Integrins
  Integrin beta subunits
   109560786 (ITGB2)
CD molecules [BR:biu04090]
 Proteins
  109560786 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 109560786
NCBI-ProteinID: XP_019818847
Position
1
AA seq 770 aa
MLRQRPQLLLLAGLLALQSVLSQECTKYKVSTCRDCIESGPGCAWCQKLNFTGQGEPDSI
RCDTRAELLSKGCPADDIMEPKSLAETRDSQAGSRKQLSPQEVTLYLRPGQAVAFNVTFR
RAKGYPIDLYYLMDLSYSMVDDLVNVKKLGGDLLRALNGITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKECQPPFAFRHVLKLTDNSKQFETEVGKQLISFVNLDAPEGGLDA
MMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKSSNEF
DYPSVGQLAHKLAESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSEDSRNVVELIKNA
YNKLSSRVFLDHSTLPDTLKVTYDSFCSNGKSQVDQPRGDCDGVQINVPITFQVKVTATE
CIQQQSFTIRALGFTDTVTVRVLPQCECQCRDASRDGSICGGRGSMECGVCRCDAGYIGK
NCECQTQGRSSQELEGSCRKDNSSIICSGLGDCICGQCVCHTSDVPNKKIYGQFCECDNV
NCERYDGQVCGGEKRGLCFCGTCRCDEQYEGSACQCLKSTQGCLNLDGVECSGRXRCRCN
VCQCDPGYQPPLCSECPGCPVPCAGFAPCTECLKFDKGPFAKNCSAACGQTKLLSSPVPG
RKCKERDSEGCWMTYTLVQRDGRDRYDVHVDDMLECVKGPNIAAIVGGTVGGVVLVGILL
LVIWKALTHLSDLREYHRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctgcgccagcgcccccagctgctgctcctagcgggcctgcttgccctccagtccgtc
ctgtcccaggagtgcaccaagtacaaggtcagcacctgccgggactgcatcgagtcgggc
cccggctgcgcctggtgccagaaactgaacttcacagggcaaggggagcccgactccatt
cgctgtgacacacgagcggagctgctgtcaaagggctgcccagctgatgacatcatggaa
cccaagagcctcgctgagacccgggacagccaggcgggcagtcggaagcagctgtcccca
caggaagtgacgctctacctgagaccaggtcaggcagttgcgttcaacgtgaccttccgg
agggccaagggctaccccatcgacctgtactacctgatggacctctcctactccatggtg
gatgacctcgtcaacgtcaagaagctggggggtgacctgctccgggccctcaatggcatc
accgagtcgggccgcattggtttcgggtccttcgtggacaagacggtgctccccttcgtc
aacacgcaccccgagaagctgcggaacccctgccccaacaaggagaaggagtgccagccc
ccgttcgccttcaggcacgtgttgaagctcactgacaactccaaacagttcgagacagaa
gtcgggaagcagctgatctcgtttgtaaacctggacgcccctgagggtgggctggacgcc
atgatgcaggtggccgcgtgcccggaggaaatcggctggcgcaatgtcaccaggctgttg
gtgttygccacggacgatgggttccactttgcgggcgatggaaagctgggtgccatcctc
acccccaatgacggccgctgccacctggaagacaacctgtacaaaagcagcaacgaattt
gactacccatcggtgggccagctggcacacaaactggcagaaagcaacatccagcccatc
tttgcagtaaccaagaagatggtgaaaacgtacgagaagctgacagagatcatccccaag
tctgcagtcggggagctgtctgaagattccaggaacgtggtggagcttatcaagaatgcc
tacaataaactgtcctccagagtcttcctggatcacagcaccctccctgacaccctgaaa
gtcacctacgactccttctgcagtaacgggaaatcgcaggtggaccagcccagaggggac
tgcgacggcgtccagatcaacgtcccgatcaccttccaggtgaaggtcacagccaccgag
tgcatccagcagcagtccttcaccatccgggcgctgggcttcacggacacggtgaccgtg
cgggtcctcccccagtgcgagtgccaatgccgggacgccagcagggacggcagcatctgc
ggcggcagaggctcgatggagtgcggcgtctgcaggtgtgacgccggctacatcgggaag
aactgcgagtgccagacgcagggccggagcagccaggagctggagggcagctgccgtaag
gacaacagctccatcatctgctcggggctgggggactgcatctgcgggcagtgcgtgtgc
cacacgagcgacgtgcccaacaagaagatctacggccagttctgcgagtgcgacaacgtc
aactgcgaacgctacgacggccaagtctgcgggggcgaaaagagggggctctgcttctgc
ggcacctgcaggtgcgacgagcagtatgagggttcggcatgccagtgcctcaagtccact
cagggctgcctcaacttggacggcgtcgagtgcagcggccgcgnncgatgccgctgcaat
gtgtgccagtgcgaccccggctaccagccgcccctgtgcagcgagtgcccgggctgcccc
gtgccctgcgcgggcttcgccccctgcacagagtgcctgaagttcgacaagggccccttc
gccaagaactgcagcgcagcgtgcgggcagacgaagctgctgtccagcccggtgcccggc
cgcaagtgcaaggagcgcgactccgagggctgctggatgacctacaccctggtgcagcgc
gacgggcgggacagatacgacgtgcacgtggacgacatgctcgagtgtgtgaagggcccc
aacatcgctgctatcgtggggggcaccgtggggggcgtcgtgctcgtcggcatcctcctg
ctggtcatctggaaggccctgacacacctgagcgacctcagggagtaccatcgcttcgag
aaggagaagctcaagtcccagtggaacaacgataaccctcttttcaagagtgccaccacg
acagtcatgaaccctaagtttgccgagagttag

DBGET integrated database retrieval system